Pay in installments of $42.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 9 - Sep 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human MIF, His tagProduct Specification Species Human Synonyms Glycosylation inhibiting factor (GIF), L dopachrome isomerase, L dopachrome tautomerase (EC: 5. 3. 3. 12), Phenylpyruvate tautomerase, GLIF, MMIF Accession P14174 Amino Acid Sequence Protein sequence (P14174, Pro2 Ala115, with C 10*His) PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFAGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight
Product Specification
| Species | Human |
| Synonyms | Glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, L-dopachrome tautomerase (EC:5.3.3.12), Phenylpyruvate tautomerase, GLIF, MMIF |
| Accession | P14174 |
| Amino Acid Sequence | Protein sequence (P14174, Pro2-Ala115, with C-10*His) PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFAGGGGSHHHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 14.2 kDa Observed MW: 12 kDa |
| Purity | ＞95% by SDS-PAGE |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Macrophage migration inhibitory factor (MIF) is a protein that in humans is encoded by the MIF gene. MIF is an important regulator of innate immunity. The MIF protein superfamily also includes a second member with functionally related properties, the D-dopachrome tautomerase (D-DT). CD74 is a surface receptor for MIF. Bacterial antigens stimulate white blood cells to release MIF into the blood stream. The circulating MIF binds to CD74 on other immune cells to trigger an acute immune response. Hence, MIF is classified as an inflammatory cytokine. Glucocorticoids stimulate white blood cells to release MIF and hence MIF partially counteracts the inhibitory effects that glucocorticoids have on the immune system. Trauma activates the anterior pituitary gland to release MIF.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.7 ★★★★★
Based on 12 reviews
Sort
Product Reviews
★★★★★ 2
Does not fit 2023 Honda Accord as it says in the title
Size: CA12290-Premium, Size: CA12290-Premium
Does not fit 2023 Honda Accord as it says in the title. Seems like good quality otherwise.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2024
★★★★★ 5
Fits Toyota 2010 FJ cruiser
Perfect fit for a Toyota 2010 FJ cruiser. Install might have been the easiest cabin filter I've done in any car that new. Remove glove box, pull out the cover and replace it. Fits great and takes odors out from it sitting for 6 months in the driveway. No notice to less airflow when on any level of fan speed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
★★★★★ 5
Comparison with POTAUTO filter: Very similar but cheaper
I bought a POTAUTO MAP 1033C and EPAuto CP846 cabin air filter to compare them for use in my 09 Legacy (gen 4). They both seemed comparable and are cheaper than most other, similar filters, though the POTAUTO was and still is ~33% more expensive than the EPAuto.
Both seem built well-enough, considering they're only being used as relatively low-flow cabin filters. That said, the EPAuto is slightly better, mainly due to the white trim piece being unattached along one side on the bottom of the POTAUTO filter. Almost certainly nothing that will affect its performance or longevity, but it is interesting considering it's the more expensive of the two. However, it must be kept in mind that this is an incredibly small sample size.
In one of my very scientific tests (/s), I held them up side by side and looked through them toward the sun (obviously being careful) to judge thickness/density and uniformity. Neither had any thin spots that I noticed, and they were pretty similar overall. One of them blocked slightly more light than the other, indicating more filtration, but I unfortunately don't remember which one. I feel like it was the EPAuto, but I don't really want to speculate as I could very well be wrong. What I do remember is that the difference was so minor that all else being equal, it wouldn't justify the cost difference between the two. In other words, even if the POTAUTO were the slightly better one, it wouldn't be worth the extra few dollars for the minimal amount of extra filtration.
In another test, I compared the filters to each other and the old filter (which I'm pretty sure was OEM, but certainly not a charcoal filter, so it was significantly thinner) by blowing air from a compressor through them. I held the nozzle at roughly the same distance from each on one side of the filters, and I held my other hand at roughly the same distance from each on the other side. The old filter, unsurprisingly, let much more air flow through. Both charcoal filters were much more restrictive due to their extra thickness, leading me to feel much less air coming through. Both were roughly the same. Both filters also held up just fine to the strong blasts of air.
I bought a couple other filters that I was going to cut to fit to use one or both with these filters as a pre-filter and/or additional charcoal layer. After the airflow test, I decided against this, as these are a lot more restrictive than OEM already, and I didn't want to push it, since that could at best cause issues with getting good airflow into the car, and at worst could damage the blower. If not for the fact many, many people have been using these and similar filters for a long time without apparent issue caused by this, I would hesitate to even use these. I haven't noticed a decrease in the airflow, but it's doubtful I would since I rarely turn the fan up past the first couple settings (usually have it on the first) if I have it running at all, and I have the center vents pulled out (to access the inside of the dash) which causes the flow at the vents to be reduced slightly.
TL;DR - Both the POTAUTO and EPAuto charcoal filters appear to be a good choice, with the EPAuto having a slight edge on build quality (based on my limited sample size of one each) and a cheaper price. Filtration appears to be very similar between the two, certainly not enough of a difference to warrant the extra price for the POTAUTO over the EPAuto. Flow is significantly more restrictive than OEM filter but doesn't appear to be an issue. I give the EPAuto 5 stars and the POTAUTO 4 stars, only because the value of the POTAUTO is a good bit less (very similar or possibly even inferior quality for 33% more money). I can't speak to their longevity or performance, but I don't imagine either should prove to be an issue.
--------------------------------------------------
As a side note relating specifically to the Legacy: replacing the cabin filter in this car is a PITA. It's not overly difficult per se, but a serious pain and certainly not something you're going to do when you have a spare few minutes. I'd rate it probably around a 3.5/10 in difficulty and a 7/10 for annoyance. While you can sort of access it by removing the manual compartment, you can't remove the tray through that. So you need to actually take the whole glove box out, which requires removing the side panel, unhooking the string/loop that keeps it from falling all the way down, and removing a few plastic screws, which can be a bit of a pain (and apparently Subaru loves them since they're all over the car). A stubby Philips driver will be helpful. Once you have the glove box out of the way, you have to unscrew several more of those plastic screws to remove the plastic cover between the glove box and the filter. This hole is where you gain access. Be careful when removing the old filter as loose dirt and debris may fall out and make a bit of a mess. You don't really want to get any in the fan below it if you can help it. Reverse the steps to reassemble it, and remember to reattach the string. Getting the glove box back in its track can be a bit of a challenge; in my experience from doing it multiple times I've found you sort of half force it and half don't. That is, it'll likely offer some resistance even if it's lined up, so if you try to baby it you'll probably be there a while, but also play with the alignment a bit to see if you can get it without marring up the tab and the slot on the right side too much. All in all, expect to spend anywhere from 15-45 minutes on this, and make sure you have a standard length as well as a shorter or stubby Philips screwdriver. I have to say, when it comes to air filters, this car is horrible. The air intake filter is a pain to change, too--much worse than most if not all other cars I've done.
--------------------------------------------------
Keywords: Subaru Legacy, fourth gen, fourth generation, 4th gen, 4th generation, 03, 04, 05, 06, 07, 08, 09, 2003, 2004, 2005, 2006, 2007, 2008, 2009
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2017
★★★★★ 5
Good price on the part and 5 min install saved me $35
Fit fine in my 4th gen 4Runner took 5mins to install
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
★★★★★ 4
Fit 4runner
Fit my 05 4runner. Good product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 2, 2025