SKU: 26283150429

Human FABP7, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FABP7, His tagProduct Specification Species Human Synonyms Brain lipid binding protein (BLBP), Brain type fatty acid binding protein (B FABP), Fatty acid binding protein 7, Mammary derived growth inhibitor related, BLBP, FABPB, MRG Accession O15540 Amino Acid Sequence Protein sequence (O15540, Val2 Ala132, with C 10*His) VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKAGGGGSHHHHHHHHHH

Product Specification


Species Human
Synonyms Brain lipid-binding protein (BLBP), Brain-type fatty acid-binding protein (B-FABP), Fatty acid-binding protein 7, Mammary-derived growth inhibitor related, BLBP, FABPB, MRG
Accession O15540
Amino Acid Sequence

Protein sequence (O15540, Val2-Ala132, with C-10*His) VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKAGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 16.6 kDa Observed MW: 16.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 7, brain (FABP7) is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. FABP7 is expressed, during development, in radial glia by the activation of Notch receptors. Reelin was shown to induce FABP7 expression in neural progenitor cells via Notch-1 activation. According to one study, FABP7 binds DHA with the highest affinity among all of the FABPs.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26283150429

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
ahindris
Houston, US
★★★★★ 5
This is a high-quality, well-designed pillow that combines softness, comfort, and adjustability
Size: Queen (Pack of 1), Size: Queen (Pack of 1)
I purchased the DreamyBlue Signature Adjustable Pillow for my husband because he often experiences back discomfort, and many of the pillows we had previously would become flat and lose their support over time. This pillow has exceeded our expectations. It is incredibly soft, comfortable, and comes with extra filling, which allows you to adjust the firmness to your personal preference. We really appreciated having that option. Even after extended use, the pillow has maintained its shape much better than other pillows we've owned. It provides a plush, cozy feel while still offering good support. My husband finds it very comfortable, and it has quickly become his favorite pillow. This is a high-quality, well-designed pillow that combines softness, comfort, and adjustability. I would definitely recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
C
Verified Purchase
Conway Bolt
Fort Morgan, US
★★★★★ 5
Finally Found a Pillow Worth Keeping
Size: Queen (Pack of 1)
I genuinely feel like I’ve tried every pillow on the market. At one point, I thought Amazon was going to flag my account because I bought and returned so many pillows trying to find the right one. This is the only pillow that made the cut. The shredded memory foam filling makes a huge difference because the pillow is both soft and supportive, while still being adjustable to fit the way you sleep. It arrives extremely full and plush, and it even comes with an extra bag of fill, which honestly surprised me. I ended up removing about half of the filling to get it exactly how I wanted it. I’m a side/stomach sleeper, which can make finding a good pillow difficult since most are either too thick or too flat. This one was perfect because I could shape it exactly how I sleep. It stays cool throughout the night, has a slightly heavier premium feel, and feels much higher quality than most pillows I’ve tried. Super comfortable, supportive, and customizable. I would absolutely recommend it and would definitely buy it again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 4
A bit expensive
Size: Queen (Pack of 1)
Waited to give a review on this one because I needed several nights before I had any idea if it was as good as everyone says. I've had a real problem finding pillows lately. Either they're too soft to provide support and I wake up with a stiff neck or they're too sturdy and I wake up with a stiff neck. Contour pillows have worked best for me, but they fall under the category of too sturdy. I also toss and turn too much at night, which means I always end up in an awkward position with contour pillows. So I took a chance on an obscenely expensive pillow, and yes, that is the reason for one less star. I'd happily pay $70 for a pillow I thought was amazing and comfortable and perfect, but this one wasn't quite it. It IS comfortable. I have slept on it for a month now without it making my neck stiff, so it does actually provide a good balance between soft and sturdy. They make it easy to stuff the pillow to your preferred fluffiness and even provide extra stuffing if you need it, which adds to the degree of comfort. While the pillow does provide good neck support, I toss and turn a bit trying to find a comfortable position when I first try to sleep. The stuffing within the pillow moves around at night, most notably shifting to the side and the pillow is notably flatter now than when I first purchased it. You can fluff it out, similarly to a down pillow, but it doesn't seem to retain its shape on its own. In some ways, that's good because what it does instead is try to retain a shape that fits you. So yes, this is a really good pillow. One of the better ones you can buy. But it's really expensive for a pillow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
A
Verified Purchase
Amber Teele
Boise, US
★★★★★ 5
Best pillow I've ever had
Size: Queen (Pack of 1)
I don't really write reviews but holy buckets, Batman. This pillow is legit. Back, neck, and shoulder pain is nothing new for me; I've had scoliosis since I was a kid and hyperflexibility in my neck since birth leading to frequent muscle spasms that have caused me to miss work. Guys. This pillow. It is the most comfortable pillow I've ever had. Like, my neck doesn't hurt and I genuinely didn't remember what that felt like. It's simultaneously supportive and soft and it doesn't sink in. The instructions are super clear to understand and the pillow fluffs up no problem if it gets a little flat. This is a game changer for me and I so hope anyone who buys this has the same experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
D
Verified Purchase
Dana K.
Draper, US
★★★★★ 5
I highly recommend this pillow, it’s great for someone with neck or back problems.
Size: Queen (Pack of 1), Size: Queen (Pack of 1)
I absolutely love this pillow! When it says it’s adjustable it definitely means that. When you first get it, it’s hard to believe that it’s going to be anything but put it in the dryer for a few minutes and it becomes so large. You will definitely have to remove some of the stuffing unless you like a really large fluffy pillow. The stuffing is high-quality and once it has been put into the dryer it becomes a fibrous type material that can be fluffed over and over and go back to the same size. It seems to be a high-quality cover on the outer portion and is thick and has a slight cooling affect. It has a separate cover on the inner portion covering the foam stuffing. I ordered this because I have neck problems and it has been super comfortable for me because I’m able to adjust it multiple times depending on my needs for the particular night when I lay down. Having the extra stuffing means that if the pillow does happen to go flat I can always add the extra that I took out when I received it. It did have a slight odor when it first came, but after putting it in the dryer, it went away immediately. I do think that’s only due to the plastic that it’s shipped in not anything with the pillow. I think this pillow is well worth it price and I would highly recommend it for anyone that is a side or back sleeper or has any type of neck problems.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026

recommand products