Pay in installments of $77.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CEACAM-3/CD66d His Tag Protein, HumanProduct Specification Species Human Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen related cell adhesion molecule 3, CGM1, W264, W282 Accession P40198 Amino Acid Sequence Lys35 Gly155, with C terminal 8*His KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 24kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation
Product Specification
| Species | Human |
| Synonyms | CEACAM3, CD66d, CEA, carcinoembryonic antigen-related cell adhesion molecule 3, CGM1, W264, W282 |
| Accession | P40198 |
| Amino Acid Sequence | Lys35-Gly155, with C-terminal 8*His KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 20-24kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Schmitter T. et al. (2007) The Granulocyte Receptor Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Directly Associates with Vav to Promote Phagocytosis of Human Pathogens. The journal of immunology. 178: 3797-3805. 2、Swanson K V. et al. (2001) CEACAM is not necessary for Neisseria gonorrhoeae to adhere to and invade female genital epithelial cells. Cellular Microbiology. 3(10): 681-691. |
Background
Carcinoembryonic Antigen-related Cell Adhesion Molecule 3 (CEACAM-3), or CD66d, is part of the CEA protein family consisting of CEACAMs and the pregnancy-specific glycoproteins (PSGs). Both CEACAM and PSG molecules have been identified in humans and belong to the much larger glycosylphosphatidylinositol (GPI)-linked immunoglobulin (Ig) superfamily. Human CEACAM-3 is ~35 kDa, consisting of an extracellular domain (ECD) containing one IgV-like domain, a single transmembrane domain and a cytoplasmic tail. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis. CD66d antibody increases neutrophil adhesion to the monolayer of human umbilical vein endothelial cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 8 reviews
Sort
Product Reviews
★★★★★ 5
My dogs are smiling!
Size: Small
I have 3 small dogs (ranging from about 10 lbs - 13 lbs). This dental toy was the perfect size. My dogs love it (with or without treats). It is durable, even after lots of chewing. I had bought another brand of the same type of toy and they bit off pieces in the first week. It really has made a difference in their teeth cleanliness and their breath is even fresher. Overall great value and my dogs love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2025
★★★★★ 1
Not Suitable For Dobermans or Labradors
Size: Large, Size: Large
In reading all of the reviews, it seemed that most dogs were just not interested in chewing the toy. It is suitable for a dog treat inside but my dogs do not have treats in toys, since both are aggressive dog chewers. Upon opening both packages, I thought this is going to be great for both of them. I purchased two, one for each of them. My male 3 year old, 92 pound European Doberman consistently kept his away from the 1 1/2 year old 65 pound female labrador mix, and within one hour we had already had a break in one of the toys. I do not know which one did it!? Nor do I care. Especially when I had to wake up at 2:30 in the morning to the sounds of vomiting dog toy pieces from my girl. Was it the material that caused the vomiting or that the material is not strong enough for an aggressive tour as advertised? Very disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2024
★★★★★ 5
Que esté bien
Size: Small
Excelente
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
★★★★★ 4
My dog does not chew on it
Size: Small
It was a described but I cannot get my dog to chew on it. She kicks the toothpaste off of ut.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
★★★★★ 5
Dogs love it and so do I
Size: Small
I have small dogs (<20 lbs) and they would chew on these forever if I let them. Never had any pieces break off. While this isn't the hardest toy to clean, it isn't the easiest either. Very worth the money and so much easier to use and safer for them. There's no danger of them breaking or swallowing part of the brush which has happened in the past. I highly recommend this dental toy, especially if your dog tries to chew on the toothbrush when you brush their teeth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2024