Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP1 His Tag Protein, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage
Product Specification
| Species | Human |
| Synonyms | LFABP |
| Accession | P07148 |
| Amino Acid Sequence | Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | >95% by SDS-PAG E& RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 13 reviews
Sort
Product Reviews
★★★★★ 5
Love it
Color: A-mz721- Multicolor, Size: Medium
Beautiful design - looks as good, if not better - than advertised, and the fit was spot-on, too. Great top at a great price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
★★★★★ 4
Pretty and comfy
Color: A-mz721- Multicolor, Size: XX-Large
Great fit, great colors...only wish ir was a bit more cotton but i'll live with it the tops so nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
★★★★★ 5
The perfect throw-on athletic dress (with built-in shorts!)
Size: Small, Color: Navy Blue
I’ve been loving this athletic dress—it’s one of those pieces that’s both functional and cute, which is hard to find. The fabric is lightweight, breathable, and slightly stretchy, so it’s comfortable whether you’re running errands, going for a walk, or just chasing kids around all day.
The built-in shorts are a huge plus. They stay in place well and make it feel more secure than a regular dress, especially on busy days. I also appreciate the pockets—they’re actually usable and don’t feel bulky.
The fit is relaxed and flowy, which I personally like because it’s easy and flattering without clinging. The straps are adjustable, so you can customize the fit a bit depending on your height or preference.
I’d say it runs true to size for a looser fit. If you want it more fitted, you could size down, but I like the casual, sporty look as is.
Overall, this is a great everyday summer staple—super easy to style with sneakers or sandals, and perfect for travel or on-the-go days. I’ll definitely be getting more colors!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
★★★★★ 5
Perfect for summer days.
Size: Medium, Color: Deep Gray, Size: Medium, Color: Deep Gray
I absolutely love this little athletic summer dress. I typically wear a size ten and ordered this in a medium and it's a perfect fit. I have the straps short so way it doesn't look baggy. It is super soft and comfortable. It is breathable and a perfect cut and length for me so so I plan on wearing it all during hot summer days. This is very versatile and easy to style by layering different things underneath it. I have a gray and leopard sports bra that is a really close shade of gray so it almost looks like it's one piece. I plan to order the teal as I have a swimsuit top that will match that color spot on. It seems like it is good quality and should hold up well to normal usage. I like that it has really big pockets , but I likely will not use them often lol. I just like the fact that if I need to have pockets they are there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
★★★★★ 4
Size down! But overall comfortable and cute and good quality
Size: Small, Color: Light Yellow
Overall it’s cute and comfortable, but my advice is to SIZE DOWN!!! I wish I would have, but I’ve already washed it so it’s too late. The straps are adjustable, but even so, I’ve had to tighten them as far as they’ll go. For reference, I am 5’1” and 125#, rectangle shaped/boxy body with a very small chest and I got a Small. The top gapes open on me and the dress is longer than I prefer for this style. Material/fabric is nice and good quality and it’s a perfect one-piece easy outfit for warm days. I like the yellow color too. It is tricky to find the right bra to wear with it, though. Got lots of compliments on it the first time I wore it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026