Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP2 His Tag Protein, HumanProduct Specification Species Human Accession P12104 Amino Acid Sequence Met1 Asp132, with C terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH Expression System E. coli Molecular Weight 16. 5kDa (Reducing) Purity 98% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer
Product Specification
| Species | Human |
| Accession | P12104 |
| Amino Acid Sequence | Met1-Asp132, with C-terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 16.5kDa (Reducing) |
| Purity | >98% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP2 is expressed solely in the small intestine, and may control development of the small intestine particularly in response to diet. FABP2 null animals were shown to be resistant to high fat diet induced obesity. FABP2 KO mice fed a high saturated fat low fiber diet showed reduced intestinal villi length and increased transit time, as well as decreased goblet cell density and paneth cell number. Epidemiological studies have long shown that the common Ala54Thr FABP2 polymorphism in humans is associated with metabolic syndrome. The Thr54 FABP was shown to have a slightly higher affinity than the Ala54 containing protein, and human fetal intestinal explants showed that subjects with the Thr54 polymorphism had increased levels of chylomicron secretion . Thus while the complete molecular mechanisms linking these biochemical and cellular observations to the population-based observations remain to be revealed, nutritional intervention strategies may prove helpful in treating metabolic syndrome in Ala54Thr carriers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 8 reviews
Sort
Product Reviews
★★★★★ 5
If Your Dog Can Rip The Hood Off Your Car--This Is The Dental Toy For Him/Her
I am always curious about buying the "number one best seller" that Amazon lists in any product category. And when it's an add-on item offered at a reasonable cost, I'm even more curious.
From reading the reviews, it appears that some dog owners ordered this item and were disappointed in it for a number of reasons, primarily because the 'hardness' of the toy caused dental problems. Obviously no one wants to buy a dental toy that actually causes teeth problems. However, some small breed owners must not be aware that their particular breed is subject to dental issues regardless of what toys they chew. Just off the top of my head, this type of problem often occurs with Yorkies, Chihauhaus, and Chinese Cresteds. You can use virtually any dental care method in existence and still watch your Chinese Crested's teeth fall out.
So small breeds shouldn't be given tough Nylabone toys like this Dinosaur model. If you watch any dog chew on this particular toy, you will quickly notice how small his/her teeth are in relation to the toy, and you will probably be surprised by the leverage and power he/she puts into each bite. They gnaw, they gnash, they continue to work at it until those tiny teeth lose the battle against the tough Nylabone. Comparing this to human teeth, everyone knows someone who fractures/cracks a tooth somehow. That's because our front "chicklet" teeth bite down on something hard, get broken from falling on your face, getting hit in the mouth, having teeth weakened by cavities, and from not seeing a dentist/hygienist on a regular basis--usually because we're afraid of a little pain.
We're always looking for relatively tough dental toys for our 182 pound Cane Corso named Dante. He tears apart any toy we buy him, usually in a matter of minutes. But this particular Nylabone Dura Chew has survived for months now. If you look at the size of his teeth, length and thickness, you will see a dog with the teeth and jaw muscles strong enough to tear the hood off your car--which is exactly what he did to our Prius. So if your dog is capable of ripping hoods off cars, this treat should be good for your pet monster. Just keep an eye on the toy so that you can toss it before it breaks down and is swallowed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2015
★★★★★ 5
Best Nylabone Fido & I Agree
My dogs love these Dino Nylabone's. Over the years I have bought at least 30 of these nylabones for 3 different dogs. Two of which have loved the Dino shaped Nylabones the best. The third loves the nylabone daily dental bone the best but the dino is a close second. The T-Rex is their favorite but they like all dino shapes. Depending on the dog's chewing mood these have lasted anywhere from a month to 6 months before needing replacing. My super chewing husky will chew one up pretty quickly in about a month, my moderate chewing pit bull would take 3-4 months and my slow light chewing shiba inu would take 6 or more months. I typically have 2-3 chewable items per dog (it helps prevent toy hoarding and aggression) and these dino toys are always among the favorites.
*These are chewing style nylabones they are not supposed to be consumed quickly as a snack or treat. I consider these like a hobby or activity for my dogs to do not something they eat or a toy they play with. Chewing is a natural part of dog behavior and is good for dental hygiene. Giving your dog items they are supposed to chew on is a good way to prevent your dog from chewing on things he isn't supposed to.*
These are the white nylabone material which is a tougher material than the beige color nylabones. The white nylabones should be used for aggressive chewers. Beige nylabones are good for light chewers.
The T-Rex is about 6" by 5" the Long neck is about 3.5" by 7 inches and the Stegosaurus is about 6.5" by 4" they all seem to last about the same amount of time.
I can usually get them for $4-5 on amazon which makes them one of the best deals for a chewing nylabone which is another huge plus.
Overall My dogs and I love the Dino Nylabones and I will buy them as long as they are made. Great Product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2015
★★★★★ 4
Dog loves it and it's very durable, but not indestructible
I have a dog with very strong jaws. She's only thirty-five pounds but she goes through most toys like they're bubblegum. Even as a small puppy, she would destroy anything and everything. By the age of five or six months we had to give up on soft and rope toys altogether, and at a year old, she is limited to only hard chews like Kong, Nylabone, etc. Even then, she destroys most of these with relative ease. She's gone through chews others have recommended as long-lasting in literally ten minutes. The only toy she has that has lasted more than a month or so is her original red Kong, which she mostly licks instead of chews.
I initially bought the dinosaur for my other, less toy-murderous dog, but the power chewer quickly stole it from him. She was in love. She carried it everywhere and chewed on it constantly. I'm not sure if it's the shape or the texture she likes, or some combination thereof, but whatever the case, it instantly became her favorite. Even the most durable hard toys normally only last a few weeks with her, but her dino is going on two or three months now. It's chewed beyond recognition, all the nubs worn down, and it's very rapidly nearing the end of its life because little bits of plastic are falling off, but it still lasted far longer than most toys do. A few weeks ago I bought her a second one, in a different shape, and she's equally as enamored with it. All in all, it's not going to be indestructible if you have a power chewer, but it certainly lasts a heck of a lot longer than most!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2012
★★★★★ 5
Tough enough to Survive the big, bad CHARLIE!
I purchased this for my 80 pound yellow lab, Charlie.
Charlie is a very powerful chewer. Toys typically last about 2.3 seconds in his grasp.
Since Charlie's toy budget had ballooned to a point where I had to choose whether to fulfill his appetite for destruction, or pay the mortgage, I knew something had to change.
This is how I came across this nylabone chew. It appeared tough enough that charlie may get at least an hour of play from this toy before it was destroyed. The price was reasonable enough that it fit within what was left of the depleted toy budget. So I bought it.
Two quick days later, and the box arrived. I gave the package to Charlie, and told him it was another new toy for him to destroy. The smell of the nylabone vented through the cardboard, and he started to wag. He tore open the box and found the bone inside. At this point, he is elated. I removed the packaging and told him to go at it.
That was weeks ago, and the dinosaur bone still has yet to be defeated. Sure, it is missing a few spines, and his tail is heavily chewed, but the bone is not yet destroyed. That isn't from a lack on trying on Charlie's part. He chews on the bone almost daily, and hasn't gotten tired of it yet!
If you have a big dog who's toy budget is getting out of control, buy this bone! Small bits will come off here and there, so if your dog likes to eat what he destroys, keep an eye on him. However, all of the small bits that have come off Charlie's bone thus far are small enough that they should pass no problem.
A great bone, and if they release similar bones in the future, Charlie will be a happy customer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2014
★★★★★ 5
Dogs who chew will love this!
I have a puggle who chews all of the time, and she has been through a variety of Nylabone products, all of which she absolutely loved. I am a huge fan of anything Nylabone, and when I saw this one, I immediately had to get it for her because not only did it look like something she would love, but the design promotes good dental health. She has had it for a month now, and she is constantly chewing on it. Not only has it helped to keep her teeth clean, but it is much more durable than other Nylabone toys. She chews it every day, carries it around and drops it all over the place, and it has barely worn at all. I highly recommend this toy for dogs who love to chew!
I do have to share one negative to this toy though.... if your dog likes you to "tug" with them for their toys, this one isn't for you. It hurts to grab and pull on it. Not much of a negative, but I want to give a fair review, so if you are looking for a strong tug toy, go with a smooth surfaced large Nylabone and save your hands some pain :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2012