SKU: 76398151096

FABP5 His Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP5 His Tag Protein, HumanProduct Specification Species Human Accession Q01469 Amino Acid Sequence Ala2 Glu135, with N terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Expression System E. coli Molecular Weight 17kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris,

Product Specification


Species Human
Accession Q01469
Amino Acid Sequence Ala2-Glu135, with N-terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Expression System E.coli
Molecular Weight 17kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 5(FABP5), epidermis is a protein encoded by the FABP5 gene. The gene encodes a fatty acid-binding protein present in epidermal cells and was first identified as being upregulated in psoriatic tissue. Fatty acid binding proteins are a small, highly conserved family of cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. The effects of FABPs are thought to include fatty acid uptake, transport and metabolism. FABP5 has been shown to interact with S100A7.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76398151096

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Su
Boise, US
★★★★★ 5
Recommended
Size: Size 5, Unit Count: 100
I absolutely love these Pampers Cruisers 360 Size 5 diapers! As a parent of an active toddler, diaper changes used to be such a struggle—but these have made a huge difference. The pull-on style is a game changer. I can quickly put them on even when my child is moving around, and the 360° stretchy waistband fits snugly without being too tight. It really feels like little “training pants,” which is great as we slowly move toward potty training. What impressed me the most is how leak-proof and absorbent they are. Even during long days or naps, they keep my child dry and comfortable. The material is also very soft and gentle on the skin, and we haven’t had any irritation or rashes at all. (They’re actually designed to be gentle and hypoallergenic, which gives extra peace of mind.) I also love the easy tear-away sides and disposal tape—it makes cleanup so quick and mess-free. Overall, these diapers are perfect for active toddlers. Comfortable, reliable, and super convenient—I highly recommend them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
Verified Purchase
Altamirano
Carnegie, US
★★★★★ 5
It's worth it.
Size: Size 7, Unit Count: 44, Size: Size 7, Unit Count: 44
I would like to provide feedback regarding a recent diaper experience. My toddler, who has a tendency to remove his diaper, has previously used Parent's Choice products since birth without issue. However, I have recently encountered a problem with both their standard diapers and Pull-Ups, specifically concerning the coverage in the gluteal region. This has led to the diaper riding up and causing a significant rash due to friction. I am pleased to report that after two hours of use, the current diaper has exceeded my expectations. My son has not removed it, and the coverage in the gluteal area is excellent. I will provide an update should any leakage occur. I also appreciate the baby powder scent and the overall quality of the product. While the price point is slightly higher than I typically prefer for diapers, my son is approaching three years old and will soon be transitioning to potty training.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
Y
Verified Purchase
Yela
Boise, US
★★★★★ 5
Movement freedom and quick changes: The ideal diaper for active babies
Size: Size 5, Unit Count: 56, Size: Size 5, Unit Count: 56
360° Flexible Fit: The standout feature is the 360° stretchy waistband that adapts perfectly to the baby's body, preventing gaps and allowing full, unrestricted movement. • Easy On and Off: Being a "Pull-On" style, it slides up in a second. For removal, it features the practical "e-z off" tabs on the sides that tear easily for a hygienic and fast change. • Designed for Active Babies: The packaging highlights an All-Around Fit specifically engineered for dynamic little ones who need protection that keeps up with them. If your baby has started moving and diaper changes have become a 'wrestling match' with traditional tabs, Pampers Cruisers 360° are the ultimate solution. They offer the peace of mind of Pampers protection with the convenience of pull-up underwear. A great investment for your child's exploration stage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
A
Verified Purchase
Ariah Baber
Waukegan, US
★★★★★ 4
Great swaddlers alternative when the Velcro became an issue
Size: Size 3, Unit Count: 136
I bought these because my daughter (12 months) started undoing the Velcro on her diapers, even through her clothes. Finding her soaking wet enough times led me to look for a solution. I really like these and will enjoy them until she finds her way out of them. They’re just as absorbent as Swaddlers and the overnights, and she never gets a rash in them. Only downside is the blowout barrier on the legs is much smaller, so she does have some blowouts out the side. The Swaddlers has more material there to prevent blowouts. These are also cheaper than Swaddlers and overall great quality. Soft and absorbent and I don’t have to worry about her even through a 13 hour sleep at night. That thing will weigh 5lbs when I pull it off her but it doesn’t leak! These are going to be our go to diapers as long as she doesn’t learn to pull them off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
K
Verified Purchase
Ksenia
Omaha, US
★★★★★ 5
Great fit and very convenient for active babies
Size: Size 4, Unit Count: 64, Size: Size 4, Unit Count: 64
These diapers are a great option, especially for active babies. The 360 design makes them easy to pull on and off, which is really convenient during quick changes. They fit well without feeling too tight and provide good coverage. Absorbency is solid, keeping things dry for a good amount of time. The material feels soft and comfortable on the skin. I also like how easy they are to dispose of after use. Overall, a reliable and convenient choice for everyday use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026

recommand products