SKU: 75995797249

VNN1/Vanin-1 His Tag Protein, Mouse

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VNN1/Vanin-1 His Tag Protein, MouseProduct Specification Species Mouse Antigen VNN1 Vanin 1 Synonyms Pantetheinase, Tiff66, Vascular Non Inflammatory Molecule 1 Accession Q9Z0K8 Amino Acid Sequence Leu24 Ser487, with C terminal 8*His

Product Specification


Species Mouse
Antigen VNN1/Vanin-1
Synonyms Pantetheinase, Tiff66, Vascular Non-Inflammatory Molecule 1
Accession Q9Z0K8
Amino Acid Sequence

Leu24-Ser487, with C-terminal 8*His LDTFLAAVYEHAVILPKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSGIYAPDSPRVFHYDRKTQEGKLLFAQLKSHPIHSPVNWTSYASSVESTPTKTQEFQSIVFFDEFTFVELKGIKGNYTVCQNDLCCHLSYQMSEKRADEVYAFGAFDGLHTVEGQYYLQICILLKCKTTNLRTCGSSVDTAFTRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVSSDGRLVSLKPTSGPVLTIGLFGRLYGKDWASGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Ykelien L Boersma. The structure of vanin 1: a key enzyme linking metabolic disease and inflammation. Acta Crystallogr D Biol Crystallogr. 2014 Dec 1;70(Pt 12):3320-9. Epub 2014 Nov 28.

Background

Vanin 1, or pantetheinase, is a glycosylphosphatidylinositol(GPI)-anchored ectoenzyme that has been shown to be widely expressed in many tissues, including the liver, kidney and gut. Pantetheinase catalyzes the hydrolysis of pantetheine to pantothenic acid (vitamin B5) and cysteamine, which together with cystamine participate in the regulation of cellular pathways involved in oxidative stress and inflammation. Germline deletion of vanin 1 in mice results in an absence of tissue cysteamine. As such, vanin 1 has been shown to both protect tissues from and sensitize tissues to damage in different disease settings. Mice that lack vanin 1 display resistance to oxidative tissue damage induced by whole-body γ-irradiation, with a reduction in apoptosis and inflammation. The absence of cellular cysteamine was associated with elevated levels of the potent antioxidant glutathione.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75995797249

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 5
GREAT suit for the price.
Color: Black, Size: X-Large
Amazing suit. Ordered an XL for my husband when we got it. Pants were very long and a little big on the waist, so we took them to get tailored for a more fitted look. I don’t like that the “pocket square” is sewn in but, it can be tucked down, so we did that and added our own that matched the tie we ordered separately. Overall, good quality for the price. We have not washed but we do take it to the dry cleaners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
E
Verified Purchase
Edmary Ramos
Natrona Heights, US
★★★★★ 3
Quality vs Representation
Color: Black, Size: Medium, Color: Black, Size: Medium
Please check clothing due to finding the blazer a bit dirty as if someone wore it with Cat hair and dust along with a dead bug and smelling a fishy smell. We ordered in advance to take it to the dry cleaners for additional wash before using. Quality is great material; tie not included be sure to measure before purchasing to avoid any tailoring.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
A
Verified Purchase
Amazon Customer
San Leandro, US
★★★★★ 5
Earned its 5 stars!
Color: Dark Grey, Size: X-Small
My husband has a thin frame and struggles to find dress clothes that fit well without breaking the bank. Since the size measurements were very detailed, we decided to take the gamble and hope for the best. This is genuinely the best fitting suit he has ever owned. It looks custom tailored. The material is great quality and the price point is even better. We suggested this suit to our groomsmen and were delighted to see it well accommodated a variety of body types. My husband loved his suit so much we bought him one in another color and had great success with that order as well. HIGHLY recommend this suit set!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
S
Verified Purchase
Shannon Mills
Waukegan, US
★★★★★ 5
1st Time Buyer
I was a little unsure about the sizing at first, but the fit turned out perfect. Definitely a great purchase the quality was on point and it did not disappoint at all.Not mention he said it was very comfortable and he looked really nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
D
Verified Purchase
Dennese
Grantham, US
★★★★★ 5
Perfect Fit and Great Quality!
Size: 4, Color: Vest Pants Set-black 2, Size: 4, Color: Vest Pants Set-black 2
I love this set! It came with everything included shirt, vest, pants, tie, and bow tie which made it a fantastic value. I bought it for my grandson, who is a tall 3-year-old (3’9 and 41lbs), so I usually size up and got a size 4. It fit him perfectly! The quality is excellent well made with great fabric not a stretchy material and it looked absolutely adorable on him. I would definitely buy this again. Great price for what you get!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 6, 2025

recommand products