SKU: 57386578826

CD34 Fc Chimera Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD34 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen CD34 Synonyms RP11 328D5. 2, CD34 molecule, HPCA1 Accession Q64314 1 Amino Acid Sequence Thr35 Thr287, with C terminal Human IgG Fc

Product Specification


Species Mouse
Antigen CD34
Synonyms RP11-328D5.2, CD34 molecule, HPCA1
Accession Q64314-1
Amino Acid Sequence

Thr35-Thr287, with C-terminal Human IgG Fc TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 72-95kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Laura E Sidney, Matthew J Branch, Siobhán E Dunphy, Harminder S Dua,and Andrew Hopkinson. Concise Review: Evidence for CD34 as a Common Marker for Diverse Progenitors. Stem Cells. 2014 Jun; 32(6): 1380-1389.Published online 2014 May 23.

Background

CD34 is predominantly regarded as a marker of hematopoietic stem cells (HSC) and hematopoietic progenitor cells. However, CD34 is now also established as a marker of several other nonhematopoietic cell types, including vascular endothelial progenitors and embryonic fibroblasts. Accumulating evidence demonstrates CD34 expression on several other cell types, including multipotent mesenchymal stromal cells (MSC), interstitial dendritic cells, and epithelial progenitors, but there remains limited recognition of the role of CD34-positive (CD34+) cells outside of each individual specialty.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57386578826

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Liamnam | Amazon Finds USA
Dallas, US
★★★★★ 5
Typecase Case: Premium Quality, Sleek Design, and Reliable Protection
Color: Pink, Color: Pink
I’m genuinely impressed with this Typecase case. From the moment I started using it, the quality of the materials really stood out. It feels sturdy, well-built, and has a sleek, professional look. The protection it offers is excellent—it fits my device perfectly and keeps it safe from scratches and minor drops without adding unnecessary bulk. I use it every day, and it still looks as good as new. One thing I really appreciate is how comfortable and practical it is. The design is thoughtful, making it easy to handle and ideal for both work and everyday use. You can tell it’s made to last
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
M
Verified Purchase
Mrs. C .Russell
Battle Creek, US
★★★★★ 5
Nice iPad Keyboard
Color: Marine Blue
My son enjoys his iPad more since he attached this keyboard. It's the perfect size, but the key is to read the specifications. He has yet to complain about a lapse in typing to seeing what he has typed so the keyboard responds well. Unfortunately, he has dropped the keyboard a few times, but thankfully it has proven to breable to withstand his roughness. The magnetic aspect of the keyboard is a nice feature and the keyboard stays in place as it should. My son does not charge the keyboard daily and he said that the lifespan of the battery is good and it lasts for several days. Although you can't compare this small keyboard to the comfort of a desktop computer keyboard, it doesn't pose any problems while typing and it gets the job done.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2026
A
Verified Purchase
alecia
Pawtucket, US
★★★★★ 5
Perfect Keyboard Case | Works Great !!!
Color: Light Pink, Color: Light Pink
Got it for my iPad 11th gen. Love love the case. It does feel a little heavy with the iPad in it but that’s okay for me. The keyboard connects instantly to my iPad. There are no glitches when typing and keys feel comfy. I love the different lights that come with the keyboard. Overall, it’s perfect
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
K
Verified Purchase
Kayla K
Belleville, US
★★★★★ 4
Good case, I’d recommend, but a few things to consider…
Color: Light Pink
I got this while it was on sale, I’d say it’s worth the money. The case itself feels nice and is functional in the aspects it says it should be. My only complaint is that it is a bit difficult to type, especially with how small the keyboard is. However, it makes sense why the keyboard is small because it’s the same size as the iPad (horizontal width wise). The color is very nice, and I really enjoy the different light options for the keyboard. The case is a bit heavy, but it’s still portable and wouldn’t be a hassle to carry around. Another thing that I didn’t quite realize when buying is that you can’t close the case with the keyboard attached, it has to be unattached for it to close. That a little annoying because I have to find a safe spot for it aside, but I suppose the perk of that is that you don’t have to have the keyboard attached to the case to use it since it is Bluetooth. Overall, good case and keyboard, and id recommend if you’re looking for something functional, easy, and affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
A
Verified Purchase
Arely Covarrubias
Battle Creek, US
★★★★★ 5
Good quality
Color: Light Pink, Color: Light Pink
This one it’s my favorite case, it makes my iPad a little computer, I love it and well this is my favorite color, good price for what you get, the keyboard syncs fast no problem and I also like that the keyboard changes color
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products