SKU: 72282155082

LILRB4/CD85k/ILT3 Fc Chimera Protein, Mouse

Sale price$279.00 Regular price$310.00
Save 10%

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB4/CD85k/ILT3 Fc Chimera Protein, MouseProduct Specification Species Mouse Accession Q64281 1 Amino Acid Sequence Gly24 Lys238, with C terminal Human IgG Fc

Product Specification


Species Mouse
Accession Q64281-1
Amino Acid Sequence Gly24-Lys238, with C-terminal Human IgG Fc GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 65-80kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4) is a member of leukocyte Ig-like receptors (LILRs). LILRB4 is encoded in the leukocyte receptor cluster, which is on human chromosome 19q13.4. The structure and function of LILRs are similar to those of other leukocyte receptor cluster receptors, such as killer cell immunoglobulin-like receptors. Leukocyte immunoglobulin-like receptor (LILRB4) is a kind of inhibitory receptor that plays a key role in immune checkpoint pathways. Inhibitory receptors also participate in achieving balance between activating and inhibitory actions to ensure immune responses to pathogens in the immune system. However, they not only protect the host from autoimmune responses, but also preserve peripheral tolerance. LILRB4 also regulates immune responses, and its role in regulating immune responses is mostly controlled by its ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72282155082

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rhonda
Bozeman, US
★★★★★ 5
Good cart.
Size: 5 Tiers (8.7"D x 39.2"H), Color: Rustic Brown + Classic Black
Very good cart. Could use better wheels, but all in all nice looking cart. Wish it came with a-hooks so you could hang pot holders or something of the like on the end b horizontal bars, but it does NOT.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
S
Verified Purchase
Savvy Shopper
Phoenix, US
★★★★★ 5
Nice Versatile and Strong Cart
Material Type: Three Tiers Cart
The cart looks great and fits our needs perfectly. It is very sturdy and well made. However, it took a lot longer to put together than I expected because there many parts and they have to fit together perfectly. Worth it though!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 23, 2025
A
Verified Purchase
Anastasio Sarigiannis
Lowell, US
★★★★★ 5
Not for someone that needs step by step instructions and pre-drilled holes
Nice cart that looks good once assembled. But be warned: there are NO predrilled holes for any of the screws. You will need to build each section of the frame that attaches to each wood panel FIRST, sit it on the wood and use a electric drill or driver to put the screws into the wood. Same goes for the wheel attachments - no holes drilled for these either. So if you are someone that can't even build a piece of IKEA furniture - this is NOT for you as this will require more skill and power tools.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2021
A
Verified Purchase
Amazon Customer
Bozeman, US
★★★★★ 4
Great Cart, Difficult Assembly
Material Type: Three Tiers Cart
This cart is beautiful and met our expectations. We read many reviews good and bad, so we knew what we were buying. The cart was packaged and delivered perfectly. It is very heavy so help may be needed. It took 4 hours to put together, there were no predrilled holes and some of the metal poles need to be adjusted slightly to fit correctly. The instructions were straightforward, drilling holes prior is very helpful. The wood was a darker brown and I actually liked the imperfections of the knots giving it character. Overall, I would buy this cart again. It is very pretty and will look amazing in our camp.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2025
P
Verified Purchase
Pamela J Arrowood
Houston, US
★★★★★ 5
Works great
Material Type: Three Tiers Cart
Easy assembly. Perfect for moving around bar area. Rolls nicely. A lot of room..
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2026

recommand products