SKU: 70448610545

Human CD90, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 17 - Sep 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD90, His tagProduct Specification Species Human Synonyms Thy 1 membrane glycoprotein, CDw90, Thy 1 antigen Accession P04216 Amino Acid Sequence Protein sequence(P04216, Gln20 Cys130, with C 10*His) QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 2kDa Actual: 18, 22, 28kDa Purity 95% by SDS PAGE Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Thy-1 membrane glycoprotein, CDw90, Thy-1 antigen
Accession P04216
Amino Acid Sequence

Protein sequence(P04216, Gln20-Cys130, with C-10*His) QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:14.2kDa Actual:18, 22, 28kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Thy-1 or CD90 (Cluster of Differentiation 90) is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Structural study of Thy-1 led to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, and led to some of the initial biochemical description and characterization of a vertebrate GPI anchor and also the first demonstration of tissue specific differential glycosylation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70448610545

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Lina
Lake Worth, US
★★★★★ 5
Fabulously bizarre and effective
These silicone socks have to be the strangest item I have ever ordered from Amazon. However strange they are, I was pleasantly surprised with them. My order came with two pairs, and I took one pair out to wash before use. I laughed at handling them then because they were a cross between hospital socks and leftover mannequin skin…trippy. The socks dried fast, so I put on foot lotion and put the socks on. The socks are beige skin tones that cover the entire foot up to the ankle, basically booties. The silicone is very soft and makes putting on and taking off the socks easy. They are also surprisingly easy to walk around in because the bottoms have grips, again, like hospital socks. I walked on tile, hardwood, and carpet with no slipping. The booties also stayed in place with no issues. I was concerned my feet would sweat, but that didn't happen. I was able to wear them for 3 hours without sweaty feet. When I took them off, my feet were a lot more soft than before or if I had used regular socks. For reference, my feet are not terrible, but the skin around my toes is dry and peeling from my picking(gross, I know). The socks I got are a size large, which worried me because they are big, but the site said for my shoe size (9) that's what I should order, and they were right. They are the perfect size and stretchy for room. I can't believe how cool and well-thought-out these socks are, on top of working. Honestly, these are among the top 20 favorite items I've ordered from Amazon. They may look incredibly strange, and they are, but they work wonders.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2025
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 3
Not well made
I have used these for 2 weeks now and one of them has a hole in the sole... I won't ever buy them again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2025
B
Verified Purchase
BZ
Massapequa, US
★★★★★ 5
Very thin and comfortable. Wash well.
Very thin sock if that is what you are looking for. They stay up and wash well. There is a toe seam but you can position it out of the way
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 10, 2025
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Great quality!
Comfortable and stylish socks for a great price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2025
B
Benjamin R. Styring
Grantham, US
★★★★★ 5
So comfy and just the right size
These are the cutest most versatile socks. The weave is just right, not too thick or thin. They don't fall or shift down your heel while walking in shoes. They launder exceptionally well. The height on the ankle is perfect for jeans, business casual pants or a quick change into gym clothes. I need more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2025

recommand products