Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 17 - Sep 22
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD9 , His tagProduct Specification Species Human Synonyms 5H9 antigen, Cell growth inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility related protein (MRP 1), Tetraspanin 29 (Tspan 29), p24, MIC3, TSPAN29 Accession P21926 Amino Acid Sequence Protein sequence(P21926, Ser112 Ile195, with C 10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11.
Product Specification
| Species | Human |
| Synonyms | 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein (MRP-1), Tetraspanin-29 (Tspan-29), p24, MIC3, TSPAN29 |
| Accession | P21926 |
| Amino Acid Sequence | Protein sequence(P21926, Ser112-Ile195, with C-10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.3kDa Actual:10kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD9 is a cell surface glycoprotein that consists of four transmembrane regions and has two extracellular loops that contain disulfide bonds which are conserved throughout the tetraspanin family. Also containing distinct palmitoylation sites that allows CD9 to interact with lipids and other proteins. CD9 is commonly used as a marker for exosomes as it is contained on their surface. CD9 has a diverse role in cellular processes as it has also been shown to trigger platelet activation and aggregation. CD9 can also modulate cell adhesion[24] and migration.[25][26] This function makes CD9 of interest when studying cancer and cancer metastasis. However, it seems CD9 has a varying role in different types of cancers. Studies showed that CD9 expression levels have an inverse correlation to metastatic potential or patient survival.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 11 reviews
Sort
Product Reviews
★★★★★ 5
Annoying sound but DOGGY TOY JOY!!
Pattern Name: Skunk
My 14 month old is squeaker OBSESSED, but she easily does surgery and defluffs. However this toy has been perfect. The sound when you shake is over the top and creates so much excitement. She loves to chase and chew this and play tug with this, and no tears from tug or points where she's tried to excise squeaker so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2021
★★★★★ 5
Great toy loved by 3 big dogs
Pattern Name: Skunk
We have a black lab and 2 grandpups (a Great Dane and a Cane Corso) that visit regularly. All 3 love this toy. All 3 destroy toys pretty quickly, sometimes within minutes. I have no idea what it is about this one, but they have not even remotely destroyed it except for major slobber damage from being so loved. I bought the first one months ago from TJ Maxx and then bought another on here thinking it could be a replacement when the first one got destroyed. The first one has yet to be destroyed. It sounds like there is a water bottle inside of it but it is some kind of coil thing. That being said, this toy can be very annoying to listen to, but we tolerate it for 3 very happy dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2017
★★★★★ 4
Not for us, unfortunately.
Pattern Name: Chipmunk
Cute idea. We have doxies. Unfortunately, they ripped the apart in 5 minutes to get to the squeaker. I'm sure other breeds are more gentle with their toys. It would be a great toy for them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026
★★★★★ 5
Very durable
Pattern Name: Chipmunk
Our dog loves this "squeaky." He got it as a gift 11 months ago and I finally had to replace it because he almost had the head and tail chewed off -- took him about a year of chewing. I almost hated to throw the old one away because the squeakers still worked! Our dog is small -- about 22 lbs. -- but is a terrier mix and loves playing tug-of-war with this Zippy toy and he also loves shaking it like crazy. It's a great value compared to the toys I find in the local pet stores. Most of those "die" because he punctures them with his teeth so they no longer squeak. This one is well worth the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2019
★★★★★ 5
My big dogs FAVE!
Pattern Name: Chipmunk, Pattern Name: Chipmunk
These are the absolute best! We bought one in store over the holidays because they don’t have the stuffing that dogs like to pull out. My big dog thinks it’s his baby, but it’s light enough for my small dogs. As it got tattered from being carried, fetched, and bathed… we needed a replacement. He doesn’t do anything without his baby. He immediately took to this as it wasn’t brand new. Success with the replacement. I will definitely be buying again, because nobody one wants a sad pup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 7, 2025