Pay in installments of $112.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
For Your Every Summer RSVP, with Code: SUMMER15
Description
HRP-Labeled ATG4B His Tag Protein, HumanProduct Specification Species Human Synonyms ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 Accession Q9Y4P1 Amino Acid Sequence Met1 Leu393, with N terminal 8*His
Product Specification
| Species | Human |
| Synonyms | ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 |
| Accession | Q9Y4P1 |
| Amino Acid Sequence | Met1-Leu393, with N-terminal 8*His HHHHHHHHMDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL |
| Expression System | E.coli |
| Molecular Weight | 45kDa |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | HRP |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Zheng X. et al. (2020) The protease activity of human ATG4B is regulated by reversible oxidative modification. Autophagy. 16(10): 1838-1850. |
Background
Initiation and development of autophagy is modulated by several autophagy-related (ATG) genes, which have been identified in yeast and human. Autophagy begins with the formation and maturation of the double-membraned autophagosomes which engulf and deliver cargoes to lysosomes for degradation. The assembling process of autophagosomes is mediated by a family of core ATG proteins, including two ubiquitin-like systems. First, inactive precursor MAP1LC3/LC3 is cleaved by protease ATG4B at the conserved C-terminal glycine residue. After a set of transfer and activation by ATG7, ATG3 and ATG12-ATG5-ATG16L1, the processed LC3 (LC3-I) finally conjugates with phosphatidylethanolamine (PE) at the exposed glycine site via a covalent bond. So far, lipidated LC3, called LC3-II, has become a biomarker of autophagy because of its characteristic of anchoring into the autophagosome membrane. Upon fusion with lysosomes, ATG4B can, in turn, deconjugate LC3-PE to release LC3-I to the cytoplasm for reuse. Hence, ATG4B serves as a priming and delipidation enzyme whose fine regulation is essential for autophagy process.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 25 reviews
Sort
Product Reviews
★★★★★ 5
Wonderful!
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
I ordered the loftier version of the pillow and I love it! I'm a side sleeper and I've been having pillow issues over the last few years where I swear every pillow is either too tall, too thin, too soft to provide support, to firm and hurts my ears, or the stuffing is too slick or something and migrates away from wherever I put my head. It's been... A time.
But this pillow has been wonderful! I've been using it for a couple weeks now and it's the perfect height for me! The latex inner chamber provides some much needed support, but the softer outer chamber gives me enough cushion to keep my ears from aching.
I will say that, while this is the perfect height for me, personally, I think that if you're someone who prefers a pretty lofty pillow, that this might not be tall enough for you. I ordered the taller version, and it feels right for me, but I've noticed in my pillow buying extravaganza that even pillows that everyone else loves that are designed for side sleepers are usually just too tall for me. So if this pillow is right for me, and you prefer a pretty lofty pillow, I really bet that this won't be tall enough in that case. It's definitely more of a medium loft, rather than a very high loft
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2024
★★★★★ 5
Read this review. This pillow saved me.
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
I have to testify about this pillow, my brothers and sisters. Ever since I hit my 30s, my body has gone down. Aches and pains. Pops. Crackles. Snaps. It’s ridiculous. Over the last 2 years, I have managed to injure a muscle in my shoulder and the pain is unbearable when it is inflamed. I finally narrowed it down to the pillow I was sleeping on. I have an attachment to a pillow I’ve owned for over 20 years - that’s another story. I could fold it 3 times and it was finally thick enough to support my head. My shoulder got so tore up recently that I had to go through 2 rounds of steroids plus round the clock ibuprofen. Waking up in the night, the whole ordeal. I ordered this pillow after much research all over the internet. I was appalled by the $165 price ticket. But when you’re in that level of pain, you’re just about willing to do whatever it takes. The first night I immediately noticed I got more consecutive hours of sleep than I had in weeks. A week later and my shoulder is pain free. I could’ve cried. The height of this pillow stabilizes my neck and shoulders perfectly. It is firm, but gives and contours to your neck and head. It’s a heavy pillow but I don’t even care. Truly I don’t think I’ll ever go back. This pillow has saved my shoulder and I’ll never stop thanking God for it. If you’re experiencing back, shoulder, or neck pain and are considering this pillow, just order it. Please. Just do it. I’m forever changed. But I’m still keeping 20 year old pillow… just for sentimental purposes. 😂
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025
★★★★★ 5
Really good pillows
Number of Items: 1, Number of Items: 1
I’ve been using this pillow for a while now and it’s honestly one of the most comfortable pillows I’ve tried. It has a soft, cloud-like feel but still gives enough support for my neck and shoulders. I’m a side sleeper and it keeps its shape well through the night. The material feels high quality, and it doesn’t go flat like cheaper pillows. Definitely improved my sleep quality and worth the purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
★★★★★ 5
Soft AND supportive
Number of Items: 1
I knew I needed a very soft pillow - all the foam pillows I had bought recently to try to upgrade our home pilllow selection seemed ok to the touch but were still too firm once I tried them out, but recently I also had some neck pain that needed some gentle support and the old old foam pillow I had that was so very soft was losing its supportive qualities and the pain wasn’t getting better. This one seemed by description to fit the bill- very soft by the company’s own definition but also with support. I’m happy to report this is exactly as advertised- the softest foam pillow I’ve tried out of the box but also good support. Pain has improved since I started using this pillow. I would buy more if we need more pillows, it’s perfect for me and I think would be comfortable for most people. I think you just need to figure out how firm you need your pillow and also height preference . I’m an all over sleeper -back, side, even belly sometimes, so it’s fine for me, but it is a little taller compared to other pillows I’ve bought recently. I didn’t compare/try other prominent pillow brands, mostly my experience is Ikea (my daughter uses a very flat and nice foam pillow from them that is even a little pricier than this one and it works well for her), and whatever brands happen to be available at target and Costco. This price point for a name brand is reasonable, I think; I was looking at other brands way over $100, and I was willing to spend that much for something that would work long term, so this one working was great. Also, this definitely does not have any cooling effect technology, which is fine by me, but something to consider if you do like cool pillows. (Although, PSA: I recently had to throw away older foam pillows that had those cooling gel panels because the gel panels started disintegrating into sticky ooze; gross and had to throw away whole pillow because couldn’t dissociate from rest of the pillow. Sad cuz the foam part of those pillows were fine.) Anyway, if you like softer pillows but want good support, this one works well and is worth trying!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2025
★★★★★ 4
Flatter than a regular pillow but nice and soft
Number of Items: 1
Is it softer than a typical memory foam pillow? Yes. But it’s also a lot flatter. I don’t find this pillow rebounds very well. It’s good for stomach sleepers but not so much for side sleepers. I’m a 2/3 of the night side sleeper so it’s unfortunately not my magic pillow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
recommand products
Advantech 2-port RS-232/422/485 PCI Express Communication Card w/Surge & Isolation
102.72
Optoma Creative Touch 3 Series 86" Interactive Flat Panel Display
2299.50
Tripp Lite by Eaton SmartRack 12U Low-Profile Switch-Depth Wall-Mount Small Rack Enclosure, Clear Acrylic Window
231.09
Accortec SFP+ Module
102.70
Samsung QE85T Digital Signage Display
1288.23