SKU: 66983101906

BMPRIA/ALK-3 His Tag Protein, Mouse

Sale price$212.40 Regular price$236.00
Save 10%

Pay in installments of $59.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BMPRIA/ALK-3 His Tag Protein, MouseProduct Specification Species Mouse Antigen ALK 3 BMPRIA Synonyms 10q23del; ACVRLK3; ALK3 Accession Q9BXN2 Amino Acid Sequence Gln24 Arg152, with C terminal 8*His QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 28kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Mouse
Antigen ALK-3/BMPRIA
Synonyms 10q23del; ACVRLK3; ALK3
Accession Q9BXN2
Amino Acid Sequence

Gln24-Arg152, with C-terminal 8*His QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-28kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):2878-83. Epub 2002 Feb 19.

Background

Activin receptor-Like Kinase 3 (ALK-3), also known as Bone Morphogenetic Protein Receptor, type IA (BMPR1A), is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the transforming growth factor beta (TGF-β) superfamily. The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A (this protein) and BMPR1B and the type II receptor BMPR2. ALK-3 plays an essential role in the formation of embryonic ventral abdominal wall, and abrogation of BMP signaling activity due to gene mutations in its signaling components could be one of the underlying causes of omphalocele at birth.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66983101906

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 5
Best tablet I’ve owned!
Style: Wi-Fi, Size: 128GB, Color: Blue, Configuration: Without AppleCare+
Fast, beautiful screen, and great battery life. The 11-inch size is the perfect middle ground for portability and productivity. Setup took less than 5 minutes. I am incredibly impressed with this iPad. The A16 chip makes everything feel snappy, from multitasking to heavy gaming. The Liquid Retina display is vibrant and crisp, making it perfect for streaming videos. Setup was a breeze, and the battery life easily gets me through a full day of use. Highly recommend for students or professionals! 5 stars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
B
Verified Purchase
Brooklynn Porter
Whiting, US
★★★★★ 5
Fantastic quality
Style: Wi-Fi, Size: 128GB, Color: Pink, Configuration: Without AppleCare+
iPad works great. I had some issues with the delivery, but once I received the package everything was fine. I use it every day and it’s super easy to use, battery life is really good and it does everything I need it to
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
H
Verified Purchase
Harold Ball
Charlottesville, US
★★★★★ 5
To use or not to use
Style: Wi-Fi, Size: 128GB, Color: Silver, Configuration: Without AppleCare+
Very easy to set up Looked brand new Works like new Well worth the money The battery lasts all damn day
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
M
Verified Purchase
Mads
Houston, US
★★★★★ 4
Its Great! Except one tiny detail
Style: Wi-Fi, Size: 512GB, Color: Pink, Configuration: Without AppleCare+, Style: Wi-Fi, Size: 512GB, Color: Pink, Configuration: Without AppleCare+
Ipad works great, easy to set up and everything transferred from the cloud from a backup I had (thank god because my other ipad is completely dead). Everything is in order except they put the magnets in the wrong spot xD. It doesnt matter functionality wise and I feel its more hassle to exchange than its worth so I am going to keep the iPad. With the case its in it doesnt really matter because theres a spot already for the pen. 4/5 stars
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
M
Verified Purchase
MarshmelloFoxyYT
New York, US
★★★★★ 5
My iPad A16 Experience
Style: Wi-Fi, Size: 256GB, Color: Blue, Configuration: Without AppleCare+
The Gameplay Handles Very Well As It's Condition Is Really Good, The Screen Protection Is Very Durable On Hard Objects Tho Especially W Scratches Which Is Surprisingly different And Ofc The Battery Life It Does Last All Day So They Are Very Reliable On Their Answer, Very Good iPad.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026

recommand products