Pay in installments of $59.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
BMPRIA/ALK-3 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen ALK 3 BMPRIA Synonyms 10q23del; ACVRLK3; ALK3 Accession P36895 Amino Acid Sequence Gln24 Arg152, with C terminal Mouse IgG Fc
Product Specification
| Species | Mouse |
| Antigen | ALK-3/BMPRIA |
| Synonyms | 10q23del; ACVRLK3; ALK3 |
| Accession | P36895 |
| Amino Acid Sequence | Gln24-Arg152, with C-terminal Mouse IgG Fc QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 45-53kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):2878-83. Epub 2002 Feb 19. |
Background
Activin receptor-Like Kinase 3 (ALK-3), also known as Bone Morphogenetic Protein Receptor, type IA (BMPR1A), is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the transforming growth factor beta (TGF-β) superfamily. The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A (this protein) and BMPR1B and the type II receptor BMPR2. ALK-3 plays an essential role in the formation of embryonic ventral abdominal wall, and abrogation of BMP signaling activity due to gene mutations in its signaling components could be one of the underlying causes of omphalocele at birth.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 5 reviews
Sort
Product Reviews
★★★★★ 5
Fantastic series by a creative artist
Format: Paperback
Amulet, a graphic novel by Kazu Kibuishi (
,
), is geared towards the 9-12 age group. However, the novel will captivate anyone that begins to read it as they are swept along a moving story with beautiful illustrations.
Our young heroine Emily witnesses the death of her father in the opening pages of this novel. Emily, her mother, and her brother Nevin move into the home of their missing great grandfather. There are secrets lurking within the house, one that soon ensnares Emily's mom. She's dragged from the basement by a tentacle through an open door and Emily and Nevin must go on a rescue mission to another world.
This story captivates the reader from the beginning. The reader is compelled to feel for the characters of the story, from Emily witnessing the death of her father to watching her mom being dragged away by some unknown creature. Although this is only the first part of the series the reader gets a true sense of the characters, their feelings, and their emotions and is left hanging at the end of this book and wanting more.
What really sells the story are the illustrations as they capture and convey the moods of the characters and their surroundings. The drawings have a light airy quality to them, with a simple, but moody, color palette to show off the extensive use of shadows to convey emotions of the character in graphic detail. The reader is never left wanting or wondering what the characters are thinking, the colors clearly display what they feel--the age of the great-grandfather is written into the lines on his face, the fear and courage of Emily as she seeks to save her what's left of her family. As the story progresses a darker palette is used and we are left wanting the lighter colors to return. Something unique about the drawings is that when the story first begins the characters almost look undefined. While we can read their emotions they are merely shapes on a page. However, as the story progresses they gain more depth and emotion.
This novel is a must read. A strong young heroine, with monsters and robots as well, enough to keep any crowd entertained. The moving illustrations and compelling story make this a great read and the book is highly recommended for all ages.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2011
★★★★★ 5
A great book
Format: Paperback
My grandson loves these novels. He's 9 and I've purchased the 7th now 2 to go
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
★★★★★ 5
A Magical Start to an Epic Series
Format: Paperback
I read Amulet: The Stonekeeper with my class, and the students couldn’t get enough of it! The artwork is absolutely stunning, and the story grabbed their attention right away. Even reluctant readers were eager to see what happened next. The mix of fantasy, adventure, and relatable characters makes it the perfect series to hook middle-grade readers. As soon as we finished, they were already asking for the next book in the series!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2025
★★★★★ 4
I thought of it as a fantastical family adventure. Great artwork Wonderful Story
Format: Kindle
First thought You killed someone in the first few pages of a kids book! Wait Disney movies kill people off too. Okay, shock over.
I likes how the mother helped keep the kids upbeat when the moved into the old home and had to clean it and on the way there she was understanding of their feelings and was encouraging them to like their new home. Even encouraging Emily to learn more about her great grandfather. Just not be like him.
Emily was super brave for a kid who watched her father die and her mother get snatched by a monster. She took responsibility of her brother and the amulet and decided to help save her mother and the world that they were in. I liked the Emily has choices not just that she has to do something because she was given the amulet but she had the choice to. She also had the choice to seriously hurt someone but she made the choice to let him live even though he wasn't the nicest of beings. I like that she lets her younger brother help out and notices when he might be better suited for the situation because of his past favorite past time ( like my son, most kids and some adults...its gaming)
The story was great. A little dark but you get the whole light at the end of the tunnel feeling. That the characters will achieve what the set out to do. I also enjoyed the whole family thing. The illustrations were wonderful. I even slowed down and went back to look at the artwork. I look forward to reading this series and being able to talk about it with my son. It was a great start to a fantastical adventure.
Now that I think about it I'd recommend this to kids around middle grade but like I said my son has been reading the series for awhile so, maybe use caution it does have monsters and evil doers and its a little dark but not so much that I wouldn't say you shouldn't read this with a younger kid. I'm actually thinking about starting it with my youngest soon.
Great characters, Wonderful story and artwork, a quick read ( at least for me, an adult), fantastical adventure. I'll continue to recommend it to others and look forward to reading it with my youngest and continuing the series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2015
★★★★★ 5
A perfect start
Format: Kindle
This is exactly the kind of graphic novel I was looking for. Full of sweetness with a little bit of bite. Reminds me of the great comic series bone. Great story, great art, I can’t wait to get into the next chapter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
recommand products
NO 1649 - Front Street, Newbiggin By The Sea, Northumberland
13.00
NO 1653 - Longstone Lighthouse, Farne Islands, Northumberland
13.00
Bath & Body Works Lavender Bergamot Hand Sanitizer
425.00
NO 1655 - Crookham Presbyterian Church, Northumberland
13.00
DESIGN ESSENTIALS - Almond & Avocado Curl Enhancing Mousse
2500.00