SKU: 65229846937

Human IL-25, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-25, His tagProduct Specification Species Human Synonyms Interleukin 17E (IL 17E), IL17E Accession Q9H293 Amino Acid Sequence Protein sequence(Q9H293, Tyr33 Gly177, with C 10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 18. 4 kDa Actual: 20, 23, 27 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Human
Synonyms Interleukin-17E (IL-17E), IL17E
Accession Q9H293
Amino Acid Sequence

Protein sequence(Q9H293, Tyr33-Gly177, with C-10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:18.4 kDa Actual:20, 23, 27 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-25 (IL-25) – also known as interleukin-17E (IL-17E) – is a protein that in humans is encoded by the IL25 gene on chromosome 14. IL-25 is produced by many cell types. This cytokine can induce NF-κB activation, and stimulate the production of IL-8 (named also CXCL8), which is the major chemotactic substance of neutrophils. Another important function of interleukin 25 is to support the Th2 immune response. IL-25 has been shown to induce the production of IL-4, IL-5 and IL-13. Because IL-25 promotes the development of a Th2 immune response, it acts to protect against several bowel infections caused by helminths. IL-25 is also referred to as the regulator of IL-9 production. Another function of IL-25 is the activation of natural lymphoid cells 2 (ILC2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65229846937

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
RQL
West Palm Beach, US
★★★★★ 5
Great sports/fitness watch
Color: Black/Yellow
I will start my review with an admission: I hate digital watches. I think 7-segment numbers look ugly, and I prefer the ability to see the 'distance' between times visually that you get with an analog face. But I needed the timer and lap counter for my job, and I have always wanted to do interval training to improve my speed and endurance while cycling. This watch had everything I needed and more. I was aware that Timex was a respected brand, and the T5E231 was the only watch in my price range with the ability to count 199 laps. I have to say, though, that after a week of use, I actually love this watch. Not only does it meet my needs functionally, but it actually brings me pleasure to wear it and operate it. The yellow trim around the inside of the bezel clearly identifies it as a sport watch, yet it seems to fit in well in formal settings. The interface is incredibly user-friendly and satisfying to operate. I never thought I would refer to a watch's "interface", but this watch actually has one. Pressing most of the buttons results in actual text being displayed on the screen telling you what the button did, or what will happen if you hold that button down just a little longer. In most modes there are even little labels that appear on the screen by the buttons telling you what they do in that mode. Figuring out how to use almost all of the functions only required five minutes of random experimentation. The only thing I had to consult the manual about was how to switch the chronograph into lap counter mode. I just wish there instructions explaining how to fold the manual back into a size that fits inside the watch stand. There are so many little touches that make it clear the designers at Timex really take pride in their work. Here are my favorites: -When turning night mode on, the Indiglo lingers for another few seconds after releasing the button. But when turning it off, the light extinguishes immediately! It should, since if you are turning night mode off, it's probably daytime and you don't need the Indiglo anymore. -Being able to scroll numbers backwards and forwards while setting times. On other watches it is so frustrating to 'miss' the number you want and have to press the button 60 more times. -Little icons appear on the home screen letting you know if the timer, chronograph, or alarm is running in the background. Most watches only have an icon for the alarm. -The speaker plays a different sound for the alarm and the timer, so you know which one is going off without looking at the screen. Also the Indiglo light flashes. -The Indiglo system is clearly a masterwork of engineering. It looks evenly lit and is very easy to read, yet it doesn't illuminate anything other than the display (unlike the backlight on a phone, for example). This must save a lot of battery power, since lighting up other objects around the watch is a waste of electricity. Besides, you have your phone for that! -In timer mode, you can see what time the timer was originally set for on another line below the countdown. -The AM and PM appear in the same place on the display; there is just one little segment that lights up to turn the P into an A. -Many of the buttons that perform an irreversible or potentially unwanted function (such as resetting the chrono or clearing workout data) require being held down for several seconds so you don't trigger them accidentally. -The watch tells you how much memory is free for storing workouts. There is only one problematic thing about this watch (and it may actually be a problematic thing about myself). In order to activate the FLIX system I am required to wrench my arm so hard I nearly dislocate it. It is painful, and takes way more effort than just pressing the Indiglo button. This doesn't bother me, because I didn't buy this watch with the intention to ever use FLIX, but it is somewhat frustrating that it is so hard to use. However, it is possible that my technique is flawed, and there is an easier movement that will activate it. But I don't really want to experiment; I like my arm in its current uninjured state. In all, I am very satisfied with my purchase. I love everything it does, and the only 'negative' probably says more about me than it does about the watch. Considering my abhorrence of digital watches, I am surprised that I like this one so much. I don't plan to wear it any other time than while at work or working out, but for those times it is not only tolerable, but actually enjoyable. I highly recommend this watch!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2013
D
Verified Purchase
Dale Buchanan
Lexington, US
★★★★★ 5
Great Buy
Color: Black/Green
Very nice watch. Simple design and I love the luminous face .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
N
Verified Purchase
Nobody-nowhere
Dallas, US
★★★★★ 5
Decent watch for the price and very easy to read
Color: Black/Blue, Color: Black/Blue
I would consider this equal to the Timex Easy Reader except without Indiglo and less expensive. It is a nice size with quoted average water resistance. It has a press-down back and mine has a gunmetal color sort of sand blasted finish case. I don't know if it's coated or the actual metal color. The strap which came with it is of the NATO type and of decent quality. In the pic it is wearing the rubber strap from my Vaer watch which is a quick release rubber one. NATO straps are fine if you don't mind the double thickness of strap between the watch back and your skin. The spring pins aren't the typical ones which have the raised parts which allow you to use a removal tool. They are quite difficult to remove but I did it using a box cutter and by applying pressure I was able to eventually work them out and put normal ones on. The strap width is 20mm. I have a bunch of other straps which I can use with this watch. The full face lume is quite bright but I don't know how long it lasts just yet. If in a couple of years it needs a new battery, don't use a kitchen knife to snap off the back, use the proper tool which you can find on Amazon and follow the online tutorials on how to get it back on. All in all it was a good purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2023
T
Verified Purchase
Tyler Mast
Battle Creek, US
★★★★★ 4
Good watch
Color: Silver/Green
This actually a good watch for the price. It glows in the dark due to solar exposure during the day. The wrist band was a little long for my first.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
Verified Purchase
Jim Crosby
New York, US
★★★★★ 5
No complaints, attractive, good work horse of a timepiece.
Color: Black/Green
Works great. I gave the luminous face a couple hours under a table lamp. When I went for my nightly half hour walk it glowed green the entire trip. Did not dim out like other watches with luminous hands/digits. So I know it glows for more than half an hour. My 2nd watch from this manufacturer. The other is an infantry watch OD green. Had it for 4 years daily use and still runs great. Changed the batt once. Could not see it in the dark at all. So, this new purchase for nights. I recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026

recommand products