SKU: 64627964437

CD38 His Tag Protein, Cynomolgus

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 19 - Jul 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD38 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Accession Q5VAN0 1 Amino Acid Sequence Leu44 Ile301, with C terminal 10*His LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGIGGGSGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 42 45kDa (Reducing)

Product Specification


Species Cynomolgus
Accession Q5VAN0-1
Amino Acid Sequence Leu44 - Ile301, with C-terminal 10*His LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGIGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 42-45kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Cluster of differentiation 38 (CD38) is a cell surface glycoprotein and multifunctional extracellular enzyme. As a NADase, CD38 produces adenosine through the adenosine energy pathway to cause immunosuppression. As a cell surface receptor, CD38 is necessary for immune cell activation and proliferation. Previous studies suggested that CD38 plays an important role in the regulation of macrophage function. Therefore, as a new marker of macrophages, the effect of CD38 on macrophage proliferation, polarization and function, its possible mechanism; the relationship between the expression level of CD38 on macrophage surfaces and disease diagnosis, treatment, etc.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64627964437

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
S Bowman
Waukegan, US
★★★★★ 3
Held Up Better Than Most for My Aggressive Chewer
Color: purple, Color: purple
I have to give the Fuufome Dog Chew Toy for Aggressive Chewers a solid 3 out of 5 stars. I have a very high-energy Lab mix named Boone who is an extremely aggressive chewer. Finding toys that last in our house is nearly impossible. This is actually his second toy like this - the first one is currently in my yard in three different pieces. While I don’t believe this toy was advertised as indestructible, I still hoped it would fully survive Boone’s chewing. Some parts have held up well, which is more than I can say for many other toys we’ve tried. However, he was still able to do some noticeable damage to the rubber portion after consistent use. To be fair, it did last longer than most toys we’ve purchased, which says a lot considering how tough Boone is on his things. For moderate chewers, I think this would hold up quite well. For truly aggressive chewers like mine, it’s tougher than average but still may show wear over time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2026
A
Verified Purchase
Amazon Customer
San Leandro, US
★★★★★ 5
Best toy for heavy chewers
Color: Green
My dog is an aggressive chewer and I have trouble finding toys that last longer than 5 minutes before being so destroyed it is no longer safe to let him keep it. He loves this toy and naws on it for hours daily. Yes, it has multiple chew marks, but it is still intact completely. No little pieces have been chewed off. I highly recommend this toy for any dog especially those who destroy every toy in seconds like mine does.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 12, 2025
N
Verified Purchase
Nirpno
Cuba, US
★★★★★ 2
NOT Indestructible and a Nylon Product (NOT A CHEW TOY)
Color: Green, Color: Green
I gave this dog toy 2-stars based on my dog toy rating system (DTRS) for “Bruce” the Green Alligator! Unfortunately, I didn’t notice in the fine print of the product description on the website that this toy consisted of Nylon. If I noticed that description, I would’ve never purchased this product. Please do your own research on Nylon wrt teeth. I wasn’t impressed with the toy construction out of the box. The nylon head and tail sandwich the rubber body with soft rubber spines on Bruce’s back for easy gripping. This is not an “Indestructible” dog toy. Safety (1-rating): 1. I was always concerned about my dog’s teeth possibly cracking while he was chewing on Bruce’s Nylon ends. Thankfully, his teeth were fine throughout the use of this toy. 2. The Nylon came off in small pieces after a few hours and continued for the life of the toy; see picture. I never intended for my dog to swallow pieces of Nylon. 3. Bruce’s rubber rear end is where most of the damage occurred, as my dog was tearing off pieces of rubber and spines, which he thankfully passed through his system over a period of 2-3 days after I threw Bruce away; see picture. 4. The chewed-up Nylon ends were very hard, rough, sharp and pointy. There were occasions where I noticed my dog’s gums were bleeding as a result of chewing this toy. 5. Bruce is big enough not to swallow in its entirety, which is why I’m giving this a 1-rating for safety. 6. This is a molded product and not a plush product. Durability (2-rating): 1. It took my dog 1 to 2-weeks to get the toy in the shape that is shown on the posted photos. 2. The Nylon was immediately being scratched and scraped apart on day-1. Then I noticed pieces of Nylon coming off of Bruce after 3-4 days. 3. The rubber was immediately being punctured with small divots around the body on day-1. I noticed over the next couple of days that my dog was focusing on the rear end and trying to pull the rubber off the Nylon tail. 4. The rubber started coming off more quickly after 1-week, until I removed it all together. Squeaker (N/A): 1. Bruce has no squeaker. Fatality (2-rating): 1. Bruce had a longer life than most of my dog’s toys, but then again, I expected this to last much longer as the seller claims it is “Indestructible”, which it is not. 2. I tried filing off some of Bruce’s chewed up Nylon ends to smooth them out for more chew time, but came to my senses and just threw him away for safety concerns only. In conclusion, “Bruce” the Green Alligator should not be given as a chew toy, but more as a fetch toy, unless you want your dog to digest the Nylon and rubber materials. Days of Enjoyment Given to Dog: 12/16/2024 Dog Toy Death: 01/08/2025 Total Days Used: 13 days (11 days spent away from home during the holidays) About my dog “Cannoli” for comparison Breed: Blue Healer / Lab mix Sex: Male Age: 8-months Weight: 45-lbs Size: Medium Energy Level: High Chew Rating: Aggressive
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2025
M
Verified Purchase
manuel rodriguez
Fort Morgan, US
★★★★★ 5
My dog loves it
Color: 1 PC-Beef-Red, Color: 1 PC-Beef-Red
The bone arrived today and my dog loves it. He is a very aggressive chewer and destroyed almost all his toys so far, even toys that were advertised for aggressive chewers unfortunately didn't held out long, the longest so far was a stuffy we couldn't find anymore and that one lasted him a few weeks but everything else lasted him an hour up to a few days max, even bones don't last him long so we have our hopes set on this bone to satisfy his chewing needs. I will update my review later on sturdiness, since we just got it and I can't review that yet but so far he loves it he has been chewing on it non stop, he already managed to get very small pieces of as shown in picture but with a regular bone he would've already been much much further. The bone is only 10 bucks so the value for money you get based on my experience so far is amazing! But also for this I will come back later to touch upon more. The size is good, our boy is a medium sized dog and this bone was advertised for medium to large size dogs and I thinks the size is just right for our boy . And there is definitely a beef flavor on it you can smell it but it doesn't smell bad it's a nice smell and not very strong but when he is chewing on it you smell it. I would based on my experience so far definitely recommend this bone but also on this I will touch back upon later if it's worth it in the long run. So far a very happy dog and owners here. Edit on May 8th (original review was on March 11th) He still hasn't managed to destroy it it's the first (cgew)toy he hasn't managed to destroy yet which is very impressive since he managed to destroy the even most toughest things we got for him in a week tops and bones within 1, 2 days tops, so we are very happy and pleased with this bone and will definitely get more later. He still enjoys chewing on it and leaves our things mostly alone for some reason he just likes stealing my things and chew on it lol. So 2 months later still stand by recommending this when your dog loves to chew and destroys everything he puts his mouth on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
J
Verified Purchase
Joy
West Palm Beach, US
★★★★★ 5
Extremely durable, dogs love them
Color: 2 PC-Beef-Red, Color: 2 PC-Beef-Red
I was looking for the toughest and most durable dog chew bone I could find and this is it. I have bought multiple other brands that claim to be very durable and tough for a very long time and this is the one for sure. The shower has described this phone accurately and it truly does last. I purchased this bone about 2 months ago. As you see from the photos attached, this is a very well made chew bone and my aggressive pitbulls can't tear it apart do they try. They never get tired of it and chewing it every single day for hours on and keeping them very occupied. I have two bones and three pitbulls that chew on it every day. It is so adorable and has an awesome flavor to it which I think entices them even more to want to chew on it. The durability and Lasting power is amazing to me with these tough chewers. I highly recommend this product to everyone out there. I will say only one negative and that is that the middle wraparound piece they were able to pull off but that is not a big deal because there is plenty of bone which was under that cover in the middle of the bone. There's a few mauled chips missing from the ends but the life of this bone is obviously going to be a long time which really surprised me. Give it a shot if you have heavy duty chewers and you will find how awesome this phone really is and it's durability and strength our second to none in my opinion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 5, 2025

recommand products