SKU: 63496511077

FABP8 His Tag, Human

Sale price$168.75 Regular price$187.50
Save 10%

Pay in installments of $46.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP8 His Tag, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms Fatty acid binding protein 8, P2, PMP2
Accession P02689
Amino Acid Sequence Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Expression System E.coli
Molecular Weight 18kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63496511077

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
dswpoodles
Los Angeles, US
★★★★★ 4
PRICE DOUBLED IN 2 WEEKS
Size: 18 Count (Pack of 1), Size: 18 Count (Pack of 1)
I rescue standard poodles mostly. I also train service dogs. My pack of "poodles" has all sizes and ages. This is not for profit , it is to save lives. Until 2 weeks ago -date now is: 08/17/2022- the price of these were around 20.00. My dogs all loved them. I have a buffet table with lots of storage I use to store the treats and it has room on top for all the treat jars. In the afternoon or evening, they'd get a hard, chewy treat like ears. Standard poodles love to chew . They could finish off one of the ears in minutes. These treats are quiet large and thin. They do smell but they are natural foods. NO WAY can I afford over 40.00 for 18 ears. Did pigs go exttict? Did they quit growing ears? How could They raise the price to cost double the amount? I looked at other ears on Amazon & the other brand i get which starts with a p- has not gone up. Paws- clipping. They have some Bizarre names so guess I'll just double my order for them. I have way too many dogs to give treats to. I want to be fair to all of them. They are my kids & will get the best I can offer. I did wait a few weeks before writting this. I also dropped my Sub & Save with this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 19, 2022
C
Verified Purchase
Chris Griffith
Los Angeles, US
★★★★★ 5
Expensive. Have to limit as I have 3 dogs.
Size: 18 Count (Pack of 1)
Dogs love.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
A
Verified Purchase
Amazon Customer
Birmingham, US
★★★★★ 5
Tula's treat
Size: 18 Count (Pack of 1)
She gets one a day and it makes her a very happy girl.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
A
Verified Purchase
Amazon Customer
West Palm Beach, US
★★★★★ 3
Dog chew
Size: 1 Count (Pack of 6)
Good quality and price dog likes it hut watch for choking
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
S
Verified Purchase
Stephanie Dutey
Belleville, US
★★★★★ 5
Finally a Toy My Pitbull Hasn’t Destroyed in 5 Minutes
Color: Blue+Red, Color: Blue+Red
I have a 65 lb pitbull who destroys most toys almost immediately, so I’m always skeptical when products claim to be “indestructible.” Most toys last maybe a few minutes in my house before pieces are everywhere. These have actually held up surprisingly well. The material feels durable and thick enough to handle really aggressive chewing, and so far my dog hasn’t been able to destroy them like he does with most other balls and squeaky toys. That alone makes these worth it to me. I also really like the size. They’re large enough that I don’t have to constantly worry about him accidentally swallowing them or choking while playing, which is a huge plus for bigger dogs. The squeaker inside also keeps him interested longer since he usually gets bored quickly with toys that don’t make noise or bounce around well. If you have a strong chewer or larger dog and you’re tired of replacing destroyed toys constantly, these are definitely worth trying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products