SKU: 17840278438

FABP1 His Tag, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP1 His Tag, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms LFABP
Accession P07148
Amino Acid Sequence Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity >95% by SDS-PAG E& RP-HPLC
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17840278438

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Destinie
Fort Morgan, US
★★★★★ 5
Absolutely works
Absolutely works! I was emptying out maybe once a week before. After taking 10 a day was emptying out one to two times a day. Don’t under-does yourself by taking 3 at first. They will not work. Take the regular amount 5-15 a day and you’ll be completely empty with ease.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
L
Verified Purchase
L Bess
Boise, US
★★★★★ 5
Effective Daily Fiber Supplement with Noticeable Digestive Benefits
Size: 2.32 Pound (Pack of 1), Style: New
I am very pleased with the Metamucil Premium Blend 4-in-1 Fiber Supplement. Shipping was prompt, and the container arrived well-packaged and sealed securely. There were no issues with leakage or damage, and it was ready to use right away. In terms of product quality, this fiber supplement performs exactly as expected. It’s made with psyllium husk fiber, which is known for supporting digestive health by helping trap and remove waste while promoting regularity. The powder mixes fairly well with water and has a smoother consistency than some other fiber products I’ve used. The orange flavor is mild and easy to drink, especially when mixed thoroughly and consumed right away. I noticed that with consistent use, it helped improve digestion and left me feeling lighter overall. The added benefit of prebiotic fiber support is also a plus, contributing to gut health over time. From a value standpoint, this product offers strong everyday utility. It combines multiple benefits—digestive support, heart health support, and appetite control—into a single supplement, making it more convenient than taking multiple products. Overall, this is a reliable, easy-to-use fiber supplement that delivers consistent results. I would confidently recommend it to anyone looking for a practical way to improve daily fiber intake and support digestive health.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
N
Verified Purchase
Nyfranco
Phoenix, US
★★★★★ 5
Excellent for Digestive Health and Easy to Incorporate into Daily Routine
Size: 2.32 Pound (Pack of 1), Style: New
I've been using Metamucil Premium Blend for a while now, and it has been a great addition to my daily health regimen. This psyllium fiber powder supplement is particularly effective for improving digestive health. The fact that it's a 4-in-1 fiber supplement is impressive. It not only aids in regularity but also helps with maintaining healthy blood sugar levels, lowering cholesterol, and promoting digestive health. The orange flavor is pleasant, making it easy to drink, and it's great that it's sweetened with Stevia, making it a sugar-free option. I appreciate that this supplement is plant-based. It's a natural way to increase my daily fiber intake, and I've noticed a significant improvement in my digestive regularity since I started using it. The texture of the powder is fine and it mixes well with water, without forming clumps. The packaging is convenient, providing 180 servings, which is excellent for long-term use. It's easy to measure out each serving, and the container keeps the powder fresh. Using Metamucil Premium Blend daily has been a simple yet effective way to enhance my overall digestive health. It's a product I trust and feel good about incorporating into my health routine. For anyone looking to increase their fiber intake for digestive health, Metamucil Premium Blend is a great choice. It's effective, easy to use, and has a pleasant taste. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2024
S
Verified Purchase
sofi saint claire
Chelsea, US
★★★★★ 5
Enjoyable to drink
Size: 2.32 Pound (Pack of 1), Style: New
Goood texture
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
R
Verified Purchase
Ryan Burns
Chelsea, US
★★★★★ 5
Lost Eight Pounds!!!
Size: 2.32 Pound (Pack of 1), Style: New
I mix two spoonfuls in a glass of orange juice every morning. In the past month I've lost eight pounds doing nothing different. Great product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products