SKU: 62262523922

Mouse Progranulin/PGRN, His tag

Sale price$130.50 Regular price$145.00
Save 10%

Pay in installments of $36.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse Progranulin/PGRN, His tagProduct Specification Species Mouse Synonyms Acrogranin, Epithelin granulin precursor, Glycoprotein of 88 Kda (GP88; Glycoprotein 88), PC cell derived growth factor (PCDGF), Proepithelin (PEPI) Accession P28798 Amino Acid Sequence Protein sequence (P28798, Thr362 Leu589, with C 10*His)

Product Specification


Species Mouse
Synonyms Acrogranin, Epithelin/granulin precursor, Glycoprotein of 88 Kda (GP88; Glycoprotein 88), PC cell-derived growth factor (PCDGF), Proepithelin (PEPI)
Accession P28798
Amino Acid Sequence

Protein sequence (P28798, Thr362-Leu589, with C-10*His) TPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.5 kDaObserved MW: 30-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Progranulin is the precursor protein for granulin. Cleavage of progranulin produces a variety of active 6 kDa granulin peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Cleavage of progranulin into granulin occurs either in the extracellular matrix or the lysosome. Elastase, proteinase 3 and matrix metalloproteinase are proteases capable of cleaving progranulin into individual granulin peptides. While progranulin is associated with anti-inflammation, cleaved granulin peptides have been implicated in pro-inflammatory behavior. Progranulin is hypothesized to be a neurotrophic factor involved in corticogenisis. Progranulin levels are elevated when tissue is inflamed. After wounding, keratinocytes, macrophages and neutrophils increase production of progranulin. Progranulin may also be involved in cancer development, atherosclerosis and other metabolic disease, Alzheimer's disease, amyotrophic lateral sclerosis (ALS) and limbic predominant age-related TDP-43 encephalopathy (LATE).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62262523922

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Ingersoll1969
Dallas, US
★★★★★ 4
Must-Have for Law Students
Format: Paperback
This is a good book. A lot of the trouble with law school exams is law professors are notoriously bad teachers, and these bad teachers write bad exams. Granted, this is a worst-case scenario, but if you've been to law school for more than one semester, there's a good chance that at least one of your professors has utterly bamboozled you into how he/she wants the final written. So what this book does is give you something of a blueprint and a method of examining fact patterns and exploring the question(s) so that you can simply go into the exam and take it without much fear. Where the book fails to be of help though, is with the IRAC method. I wholeheartedly agree that IRAC is a too-constrictive method of writing that tends to inhibit most students from really expressing what they know. Law professors largely want a mechanical recitation of rules followed by mechanical analysis, so law students spend hours and hours memorizing rules with the ultimate purpose of using them in an IRAC format. It's absurd, but that's the way it is. And this book simply dismisses the fact that lazy law professors love IRAC for the fact that it gives them a template from which they can read and score exams quickly. But still, you can construct an IRAC using this method, it just doesn't lend itself seamlessly to it, which is pathetic--not with respect to GTM, but to the teaching and testing methods used by professors. If you don't believe me, and if you haven't already done so, go look at model bar answers from your state and see if they employ a rigid IRAC formula. They don't. And so to me, that's what this book was good for--being able to write bar exam quality answers that leave room for a different writing styles and methods of analysis. If you're just starting law school, buy this book. If you're already in and still struggling, buy this book. If you're the king or queen of fastidious, multiple, anally retentive headers on your exams, read this book and go look at bar answers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 22, 2016
A
Verified Purchase
autofila
West Palm Beach, US
★★★★★ 5
The ONLY MARKET-AVAILABLE "ISSUE-IDENTIFICATION" book!!!
Format: Paperback
I purchased it twice: the first time in the law school, but I had misplaced it in the school library & lost it. The second time: while preparing for a BAR exam, I have realized that I material, but I was still missing issues. The book helped. Also, I did not get it on my first read & deeply dissatisfied. But, upon reading the second time & reading it later, I have gotten the point completely. The book helps to formulate what the issues are & you have to understand how to "uncover" the issues prior to formulating the issues. The book helped again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 15, 2024
J
Verified Purchase
Jacob Hakim
Omaha, US
★★★★★ 5
"It Depends"
Format: Paperback
Was a great read up until I decided to not enroll in law school, at which point I cast it aside. It gets very technical about how to write exams, how to think like a law school student. Might as well be called "It Depends," because lawyers are contextualists. Do you really want to go 200k in debt though? Or even 40k total debt at that safety school with the nice scholarships? Is there something you're trying to prove? It's all love on this end; I'm just trying to help you make the right decision, even if it puts you back at square one. Give computer science another shot. Or business analytics. Heck, even video editing! But if you really think law is suitable for you (and it may well be), then grab this book your 0L summer and crush 1L. You already know you're smart. Now you just have to work hard and take the right steps, which this book will outline for you. Also you can negotiate scholarship amounts if you have leverageable offers from peer schools. Good luck, lost girl/boy/zem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 1, 2018
S
Verified Purchase
Sleven
Lowell, US
★★★★★ 5
Great book for 1Ls or those prepping for Law School
I bought this book in order to prepare for law school and it's amazing. The information is invaluable. It's easy to read and written in a way that makes the information interesting. I recommend this book to anyone preparing to go to law school. It provides very useful information on how to prepare for law school exams that I found especially helpful. Great book, well organized and well written.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2016
M
Verified Purchase
monica guajardo
Massapequa, US
★★★★★ 5
Competitive Edge! Highly recommend!
Format: Paperback
This was one of the best investments I made before I started law school! I read this book July-August before my first semester. Even though I hadn’t taken any classes just yet, it provided me with a decent roadmap for approaching my classes while prioritizing strategy for my finals. I then reviewed the main points of each chapter, especially the last few chapters, in October to make sure I was preparing well with finals fast approaching. Long story short, this book gave my a competitive edge over many of my peers for every final I took! I finished my first semester with all As and in the top 2.5% of my class. Highly recommend! Do yourself a favor, start early, and always remember that the ultimate answer to many law school is exams is “maybe”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2020

recommand products