SKU: 80233892887

Human CD99, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD99, His tagProduct Specification Species Human Synonyms 12E7, E2 antigen, Protein MIC2, T cell surface glycoprotein E2, MIC2, MIC2X, MIC2Y Accession P14209 Amino Acid Sequence Protein sequence (P14209, Asp23 Asp122, with C 10*His) DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 11. 8 kDa Observed MW: 17, 30 kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms 12E7, E2 antigen, Protein MIC2, T-cell surface glycoprotein E2, MIC2, MIC2X, MIC2Y
Accession P14209
Amino Acid Sequence

Protein sequence (P14209, Asp23-Asp122, with C-10*His) DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 11.8 kDa Observed MW: 17, 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD99 antigen (Cluster of differentiation 99), also known as MIC2 or single-chain type-1 glycoprotein, is a heavily O-glycosylated transmembrane protein that is encoded by the CD99 gene in humans. The CD99 gene does not undergo X inactivation on the X chromosome and it was the first such pseudoautosomal gene to be discovered in humans. It is expressed on all leukocytes but highest on thymocytes and is believed to augment T-cell adhesion and apoptosis of double positive T cells. It also participates in migration and activation. It is found on the cell surface of Ewing's sarcoma tumors and is positive in granulosa cell tumors. It is more expressed in malignant gliomas than in the brain, and such overexpression results in higher levels of invasiveness and lower rates of survival. Antibodies to CD99 are used in diagnostic immunohistochemistry to distinguish Ewing's sarcoma from other tumours of similar histological appearance, as well as for the identification of thymic tumours, and of spindle cell tumours, such as synovial sarcoma, haemangiopericytoma, and meningioma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80233892887

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Erica booklover
Cuba, US
★★★★★ 5
🩶
Format: Kindle
🩶Small town 🩶Opposites attract 🩶Sapphic romance 🩶Witness protection 🩶Sheriff/ waitress 🩶Femme/femme Ava witnesses a murder of a congressman and is forced into witness protection and relocated to Cedar falls. This is where she meets sheriff Lou. Chapter 1 had me quickly drawn in as it starts with Ava witnessing the murder after her shift. The tension was palpable. The writing was perfect. I really enjoyed this book. The crime/mystery along with the romance made the story intriguing. Lou and Ava slowly start to develop a beautiful relationship with undeniable chemistry. There is just enough angst that had me stuck wanting to know how the book was going to end. Towards the middle of the book we get Lou’s backstory which pulled at my heartstrings. She went through so much as a child which explained why she was so closed off as an adult. The spice was sweet and well written. This book gave me all the feels. It’s fun, mysterious, intense, emotional and hot. I feel so much happened in 300 pages and I still craved more. The ending was wrapped up perfectly with a HEA. Lastly, I was so happy to see chapters titles! Seems to be a rare occurrence these days.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2025
S
Verified Purchase
Shannon Cross
West Palm Beach, US
★★★★★ 5
Perfect debut novel!
Format: Kindle
I had no idea this was Ms. Elle's first official debut! Story was lovely and the flow harmonious...the only indication of the author being British was the reference to an already described sweater as a jumper...but since I love British authors it only added to the charm. No real angst and not really what I would classify as a slow-burn (rather a realistic relationship timeline) made for a quick read! Can't wait to read what she writes next!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2025
C
Verified Purchase
Chyrl Ann Brown
Lexington, US
★★★★★ 5
Great read.
Format: Kindle
Once I started this book I kept reading. I enjoyed the story and complex issue bys with both characters, especially with the never having been with another woman for Lou. In this day of self publishing I commend you there were no errors. I will, anxiously, await your next body of work. Thank you for the great read. ,,,
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2025
J
Verified Purchase
Jessica Stover
Pawtucket, US
★★★★★ 5
Unputdownable!!!
Format: Kindle, Format: Kindle
This is about Cami, at seventeen years old her family home was broken into and her life tragically changed forever. Eleven years later and she's finally living as normal of a life as she can despite the trauma, when she receives an anonymous phone call with a cryptic message asking if she would like a "do over". Then she receives a link to a video of a boy trapped in a room with bars on the windows and she is told she has 4 days to find him. Her heart stops when she sees the boy's face because he looks so familiar, but it couldn't be what she's thinking, could it? She knows she needs to help him but was told she can't contact the police, so the next best thing she can think of is an old classmate named Rex who she remembered did something in the military with computers. Now Cami and Rex are on a race against time to figure out the secret location of where the video is coming from and where this little boy is being kept before it's too late. But there is so much more than they realize going on and they uncover more and more secrets along the way, the little boy is just the beginning of what they're about to unravel about their past and their futures. This book was truly unputdownable! It captures your attention right from the first chapter and keeps you on the edge of your seat, grasping for answers while finding out secrets that only lead to more questions. I had no idea where this story was going or how it was going to end, and I loved that I couldn't predict what was going to happen. It had suspense, trauma, mystery, heartbreak, loss, healing, romance, found family, second chances, and a happy ending. (*Please make sure to check trigger warnings, it also does have dark topics.) Everything from the beginning to the ending was so well done, so much thought was put into these characters, their back stories, the connections, even down to the details. Five stars doesn't feel like enough for this book, Mia absolutely blew me away with this story! Books like this are why I love to read! ❤️📚
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 23, 2025
T
Verified Purchase
The Midnight Snack Reviewer
Belleville, US
★★★★★ 4
Great read
Format: Kindle
It’s honestly rare to find a book that manages to be both a gripping thriller AND an emotional, hopeful story at the same time, but this one somehow pulled it off. The story follows Cami, whose entire life is shattered after a brutal home invasion leaves her traumatized and her mother and younger sister dead. Right before everything happened, she had just found out she was pregnant and was preparing to start her future, so watching everything get ripped away from her was absolutely heartbreaking. Years later, Cami has rebuilt a quiet life for herself and is finally finding some sense of peace… until she receives a phone call telling her there’s a little boy being held captive somewhere in a cabin in the woods. And that’s when everything starts unraveling again. The search for the missing child reconnects her with Rex, a former classmate who became an outcast in the aftermath of the original tragedy. After being unfairly viewed as suspicious by the community despite being cleared, Rex lost the scholarship that was supposed to change his future and eventually enlisted in the military. Now he’s this highly skilled tech expert carrying around his own trauma and pain, and honestly I really liked his character. What I appreciated most about this book was how layered it felt. Underneath the mystery and suspense, it’s really a story about survival, trauma, resilience, and how people try to rebuild themselves after unimaginable loss. Mia did a really good job balancing the darker subject matter with moments of hope and healing without making either side feel too overwhelming. The opening of this book is INTENSE and immediately hooks you. There were definitely moments where my interest dipped a little in the middle because the pacing shifted and the story started unfolding in a different direction than I expected, so I had to kind of regroup and settle into what the story was trying to do. Some of the execution did not fully work for me all the time, especially with certain reveals being held back for later impact, but overall I was still really invested in uncovering the truth. I also really liked that even some of the characters I disliked ended up getting endings that felt satisfying in their own way. The mystery kept me engaged, the emotional elements hit hard, and the characters felt layered and human. It’s dark, tragic, hopeful, suspenseful, and ultimately a story about surviving things that should have destroyed you. Just definitely check trigger warnings beforehand because this book does contain violence against women and some heavy subject matter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products