SKU: 59221990417

CEACAM-3/CD66d Fc Chimera Protein, Human

$279.00 $310.00
Save 10%
No.2 Bestseller on sm10m.ch >

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-3/CD66d Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen related cell adhesion molecule 3, CGM1, W264, W282 Accession P40198 Amino Acid Sequence Lys35 Gly155, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen-related cell adhesion molecule 3, CGM1, W264, W282
Accession P40198
Amino Acid Sequence

Lys35-Gly155, with C-terminal Human IgG1 Fc KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight

45-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Schmitter T. et al. (2007) The Granulocyte Receptor Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Directly Associates with Vav to Promote Phagocytosis of Human Pathogens. The journal of immunology. 178: 3797-3805.

2、Swanson K V. et al. (2001) CEACAM is not necessary for Neisseria gonorrhoeae to adhere to and invade female genital epithelial cells. Cellular Microbiology. 3(10): 681-691.

3、Hasselbalch H C. et al. (2011) High expression of carcinoembryonic antigen-related cell adhesion molecule (CEACAM) 6 and 8 in primary myelofibrosis. Leukemia Research.

Background

Carcinoembryonic Antigen-related Cell Adhesion Molecule 3 (CEACAM-3), or CD66d, is part of the CEA protein family consisting of CEACAMs and the pregnancy-specific glycoproteins (PSGs). Both CEACAM and PSG molecules have been identified in humans and belong to the much larger glycosylphosphatidylinositol (GPI)-linked immunoglobulin (Ig) superfamily. Human CEACAM-3 is ~35 kDa, consisting of an extracellular domain (ECD) containing one IgV-like domain, a single transmembrane domain and a cytoplasmic tail. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis. CD66d antibody increases neutrophil adhesion to the monolayer of human umbilical vein endothelial cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 59221990417

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Joseph McBee
Cuba, US
★★★★★ 5
A Book to Read and Read Again
Format: Hardcover
I finished this book a few days ago and have been obsessing over it in my mind ever since. Hooten Wilson (which is a delightfully fun name) is a brilliant scholar, excellent guide/teacher, and lover of Christ and the written word and all of that shows on every page. This book is a call to look up from our screens and dive deep into the written word, both Scripture and literature. It is equal parts inspiring and practical. The robust and rich writing of the author is still easily accessible. As one who grew up in love with books and reading, I moved to almost exclusively non-fiction in my adult years. This book inspired me to return to the beauty of fiction once again and to see the value of the written word as a way to love God, not just to gather and process information. I will definitely be reading this one again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2023
P
Panda Incognito
San Leandro, US
★★★★★ 4
Rich Academic Insight
Format: Hardcover
Near the beginning of "Reading for the Love of God," Jessica Hooten Wilson addresses why we should read fiction, responding to arguments in some Christian circles that we should only read the Bible. Other topics that she covers include the difference between using and enjoying books, how reading can help us develop greater virtue, and how we can rightly interpret books through the "trinity" of rightly balancing the text, the author's intent, and our own takeaways, instead of forcing the text to mean whatever we want. She also shares "bookmarks" between chapters about the reading lives of Augustine of Hippo, Julian of Norwich, Frederick Douglass, and Dorothy L. Sayers. These sections are thoughtful and encouraging, and the latter two are my favorite parts of the book. There is a recommended reading list at the end that offers many wonderful selections, but I want to offer one quick warning. She includes the graphic novel adaptation of Octavia Butler's "Kindred" in her list for school-age readers, and although she mentions that it's more for the 10-12 age range, it is an adult book. The main character is an adult, and the graphic novel includes vivid on-page depictions of racial violence, attempted rape scenes, and a lot of talk about rape. Some older kids can handle that, but it would terrify others and was never intended for that age group. Reading and the Bible Hooten Wilson emphasizes that enhancing our reading skills through literature will help us better read, understand, and appreciate the Bible. She makes excellent points about how learning to read different literary genres will help with biblical interpretation, and she makes a convincing case for how practicing our interpretive skills and becoming more fluent with metaphor and other literary devices will enhance our experience with the Bible. However, I felt that she sometimes went too far, making it sound like Bible-reading is an activity for the well-educated and well-practiced. God intended the Bible for everyone regardless of their socioeconomic class, abilities, or educational level, and even though reading the Bible badly can have negative consequences, this book focuses more on our own literary skills than the power of the Holy Spirit to reveal truth to us, convict us, and comfort us through Scripture. Hooten Wilson provides excellent next steps for people who want to deepen their relationship with the Bible, but I wished that she had articulated additional vital context around this. Audience This book is highly academic in content and tone, and even though I enjoyed this book and found it very enriching, it is only for serious readers. Hooten Wilson writes about highly abstract concepts in complex ways, and she often uses specialized vocabulary without explaining what she means. She also makes lots of references to monastic practices and obscure literary works that even highly bookish Christians are unlikely to be familiar with. This book shares rich scholarly perspectives, but it is not for reluctant or casual readers, especially since Hooten Wilson only acknowledges the worth of popular-level books in the special section on Dorothy L. Sayers. It disappoints me that Christian books about reading are almost always written at such a lofty level that they are inaccessible to the people who need them most. I read hundreds of books every year, including dozens of academic ones, but I still felt that parts of the book were beyond me. If someone wants to begin getting more serious about reading, I would recommend Karen Swallow Prior's "On Reading Well" as a more accessible alternative with similar themes. My other concern is that Hooten Wilson was always the expert in the anecdotes she shared, never the person learning something new. Only one anecdote bothered me in and of itself, and that is the chapter-opening illustration about a time when she set up an undergrad student for embarrassment to make a point during class. The other anecdotes don't involve power differentials and were perfectly fine, but taken together, they give the impression that the author needs to feel superior. I am sure this was unintentional, but I wish she had given examples of times that she lost an argument and learned something new. Conclusion Overall, I enjoyed "Reading for the Love of God," appreciating Hooten Wilson's unique insights and her scholarly perspective on the spiritual importance of reading. This book is deep and thoughtful, and there are a lot of important messages about reading great books to expand your mind, enhance your understanding of Scripture, and become closer to God. However, this book is so dense and academic that it is only for scholarly readers. I wish that this book could be an on-ramp for people who want to get more serious about reading, but it will probably just make them feel judged, lectured at, and so overwhelmed that they give up. This book has great value for people who inhabit the author's literary world or are so well-read that they can make the leap, but I hope that the she will consider ways to effectively reach popular audiences in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2023
K
Verified Purchase
Karissa Lynn
Lowell, US
★★★★★ 5
Inspiration and affirmation of the richness of a reading life
Format: Hardcover
I listened to Hooten Wilson give a talk about the book and immediately pre-ordered it. It did not disappoint. I haven’t binge read a book like I did this one since last year with Abolition of Man. It was a delight to learn more about some extraordinary and diverse readers such as Julian of Norwich, Frederick Douglas, Dorothy Sayers and others. Hooten Wilson does an excellent job make a case for the ways reading both the Word and literature expands our capacity for living rightly and for reflecting God.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2023
T
Verified Purchase
Timothy Shea
Lake Worth, US
★★★★★ 5
Reading as worship?
Format: Hardcover
Dr. Wilson inspires us to see and appreciate reading with new eyes and hearts. This is a book I’m planning to add to my college literature syllabus and even my book club!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 22, 2024
C
Verified Purchase
Cryolitterae
Dallas, US
★★★★★ 5
An excellent survey of Christians should read
Format: Kindle
I love how complicated ideas are presented in a very simple way. This deserves to be read alongside Joshua Hren's How to Read like a Catholic
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2023

recommand products

Johara Dresser
710.00
Holsted Queen Bedroom Set
773.00
Holsworthy Dining Table
381.50
JALEN White 9" Euro Top Mattress, Cal.King
253.50
HURLEY Black Counter Ht. Bench
144.00