SKU: 1462791892

TIGIT His Tag Protein, Mouse

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TIGIT His Tag Protein, MouseProduct Specification Species Mouse Accession NP_001139797 Amino Acid Sequence Gly26 Thr143, with C terminal 6*His GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGTGGGSGGGSHHHHHH Expression System HEK293 Molecular Weight 18 28kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Mouse
Accession NP_001139797
Amino Acid Sequence

Gly26-Thr143, with C-terminal 6*His GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGTGGGSGGGSHHHHHH

Expression System HEK293
Molecular Weight 18-28kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

T-cell immunoreceptor with Ig and ITIM domains (TIGIT), also known as VSIG9, VSTM3, and WUCAM, is a member of the poliovirus receptor family of immunoglobulin proteins. TIGIT is expressed at low levels on subsets of T cells and NK cells, and is upregulated at the protein level following activation of these cells. TIGIT marks exhausted T cells in the tumor microenvironment and during human immunodeficiency virus (HIV) infection. Research has shown TIGIT interacts with several receptors expressed on antigen presenting cells, such as dendritic cells and macrophages, as well as tumor cells and cells of the microenvironment. TIGIT binds with high affinity to PVR/CD155, and with low affinity to Nectin-2/CD112 and Nectin-3/CD113. Upon binding to its ligands, TIGIT suppresses T cell activation, and inhibits T and NK cell cytotoxicity. This inhibition can be blocked using monoclonal antibodies directed at the extracellular domain of TIGIT, resulting in rejuvenated antigen-specific CD8+ T cell responses in tumors and during HIV infection. Three potential isoforms of TIGIT have been computationally mapped.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1462791892

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kid Mars
New York, US
★★★★★ 5
A Solid Monitor Stand
Size: Single, Style: Free-Standing
This is an extremely sturdy monitor stand. Easily assembled in less than 20 minutes. Instructions were simple. The hex tools came with the stand, but you just need a Nr 2 Phillips Screwdriver for the bolts mounting the VESA plate to the monitor. Take note that this stand has a heavy base to hold larger/heavier monitors up to 22 lbs, but does not take a lot of space. I chose this variant so that it could handle my heavy 24-inch Planar monitor. The included cable management clip was a nice touch. Rotation and tilt feature moves easily and has decent range. I'm very happy with my purchase and it was available for overnight shipment in my region.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
E
Verified Purchase
Everyday Reviews
Massapequa, US
★★★★★ 4
WALI Dual Monitor Stand: A Solid, Space-Saving Base Camp
Size: Dual, Style: Free-Standing
WALI Dual Monitor Stand: A Solid, Space-Saving Base Camp I needed to reclaim some real estate on my crowded desk, and this WALI freestanding mount did the trick. It's a straightforward, no-frills solution that holds my two 24-inch monitors securely and opens up a ton of space underneath. Assembly is intuitive, though having a second pair of hands is helpful when you're attaching the monitors to avoid any tipping. The all-metal construction feels sturdy and reliable. The adjustments are basic but effective—you can raise or lower both monitors together on the central pole and tilt or swivel them individually to get the angles just right. The included cable management clips are a nice touch for keeping things tidy. The key thing to understand with any freestanding mount is balance. If you extend the arms all the way out toward you, the whole unit can get top-heavy and want to tip forward. I keep my monitors positioned more centered over the heavy base, and it's perfectly stable. It's not meant for dramatic, extended poses. For the price, it's fantastic value. It doesn't have the infinite, fluid adjustability of high-end gas-spring arms, but it doesn't need to. It lifts your monitors, frees up your desk, and does its job without any fuss. Bottom Line: An excellent, budget-friendly way to lift two monitors and dramatically increase your usable desk space. Just be mindful of the center of gravity and don't expect ultra-flexible, independent positioning.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2025
E
Verified Purchase
Erik Okerholm
Battle Creek, US
★★★★★ 5
Nice, sturdy, and supportive and easy to set up for my dual 27" monitors!
Size: Dual, Style: Free-Standing
Nice, sturdy, and supportive and easy to set up for my dual 27" monitors!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
N
Verified Purchase
Needsmorenails
Phoenix, US
★★★★★ 5
Easily supports a pair of 26" displays
Size: Dual, Style: Free-Standing
I have no complaints with this stand. It is not as nice as the Inland brand sold at MicroCenter, but it does its job. It beats the price of the MicroCenter one, thats for sure. It comes with all the hardware you might need, even long screws and bushings if you have a display that needs them. Assembly was quick. It comes mostly assembled anyway. You have to put the bottom on the post then attach the assembled arms to the post. Setting up can be a challenge but with help, its easy. After mounting the bracket on the back of the displays, you just slide them into the receiver on the arms. Once mounted, adjusting the position is simple, but can take a while as there are several joints which can be positioned to angle the displays as you like. The cord clips do an OK job of cord management, but the clips are not as good as the Inland ones. They do the job, but not as durable. I broke the one that goes on the post, but I tried getting it to hold a wad of wire. My fault. I recommend this stand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
J
Verified Purchase
Joshua Jordan
Port Orchard, US
★★★★★ 5
It's simple, it works, & its price makes for a good deal
Size: Single, Style: Free-Standing
I needed a stand for a 27" VIZIO TV that had been wall-mounted for a few years, & (?) the original stand must've got the toss long ago... It's hard to say... I found this stand on Amazon priced right, plus it had a coupon attached to the listing. I scrolled down & I saw a "newer model" of the same product was available, so I was initially hesitant. But, looking at the product pictures, reading the description, & scanning through some of the reviews, then the same with the "newer model" — the only difference I could see was mostly aesthetic (it also appears to have a desk mount included, which wouldn't have worked for me regardless of its purpose—either for conversion to a desk stand-off mount, or to further secure the stand....?) Eventually, I just thought "....it's a stand with a VESA mount; how do you **** that up...?" And I really couldn't think of anything...even if the VESA bracket was milled not to spec (it is milled to spec), I could have still made it work....(?) So, I made the purchase, received it, & 9-10 screws later, the TV had a stand. & I'm guessing a much more versatile stand than the original. The bracket that attaches the stand to the VESA mount can lower or raise the TV quite a bit. Even in it's highest position, it's still retains its sturdiness & remains stable. The baseplate has a decent amount of weight, and its overall design is well balanced to favor stability (to a tolerance; e.g., an old CRT monitor just isn't going to work). The stand is literally 4 basic pieces—the VESA bracket, an articulating bracket, a metal tube, & a metal baseplate. If you have a standard phillips screwdriver, then the stand is easy to assemble. If you have any experience with TV mounts, or TV stands, then it assembles in less than 15 minutes. Given what you get for the price, the ease of assembly, the added versatility, if you need a stand for a screen within the manufacturer's specific tolerances, then I would absolutely recommend this stand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2021

recommand products