SKU: 59167157463

KIF7 Protein

Sale price$241.20 Regular price$268.00
Save 10%

Pay in installments of $67.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

KIF7 ProteinProduct Specification Species Human Synonyms Kinesin like protein KIF7KIF7 Accession Q2M1P5 Amino Acid Sequence L8 V355

Product Specification


Species Human
Synonyms Kinesin-like protein KIF7,KIF7
Accession Q2M1P5
Amino Acid Sequence

L8-V355

LPGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVVLAEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLLEDEQGIVPRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCGVKEVDVEGLDEVLSLLEMGNAARHTGATHLNHLSSRSHTVFTVTLEQRGRAPSRLPRPAPGQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIPYRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATV


Expression System E.coli
Molecular Weight 40.2 kDa
Purity >90% by SDS-PAGE
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 59167157463

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KCo
Battle Creek, US
★★★★★ 5
Good flavor!
Flavor Name: Variety Pack 2, Size: 16.5 fl oz (Pack of 4)
Great flavors, versatile. Good quality syrups!!! Nice value for the money and shelf life is awesome! Flavors consistent as I’ve purchased more than once.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
M
Verified Purchase
Monica M
Chelsea, US
★★★★★ 5
Café-Quality Sauces at Home ☕🍫
Flavor Name: Variety Pack 2, Size: 16.5 fl oz (Pack of 4), Flavor Name: Variety Pack 2, Size: 16.5 fl oz (Pack of 4)
Absolutely love this Torani Puremade variety pack. Every sauce tastes rich, smooth, and high quality just like what you’d get at a coffee shop. The caramel is perfectly buttery, the white chocolate is creamy (not overly sweet), and both chocolate sauces are deep and indulgent. They blend beautifully into hot and iced drinks, drizzle great over desserts, and the squeeze bottles make them super easy to use with no mess. I also really appreciate that they’re made with no artificial flavors or preservatives. If you’re building a home coffee bar or love elevating desserts, this set is 100% worth it. Would definitely repurchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
D
Verified Purchase
D.Diana
Phoenix, US
★★★★★ 5
Gourmet drizzle of deliciousness
Flavor Name: Variety Pack 2, Size: 16.5 fl oz (Pack of 4)
Torani is a great product - very happy we were able to order them through Amazon. They last without being refrigerated (but we go through them fast during parties). The syrups taste like they're from an ice cream shop - we use them for ice cream parties for variety. This set is a great price compared to buying in-store. The syrup is not watery, it's a nice thick syrup that is great for coffee or desserts. The consistency is not as thick as a fudge topping, but thick enough to drizzle, if that makes sense. Will buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
K
Verified Purchase
Kindle Customer
Whiting, US
★★★★★ 5
Great quality
Flavor Name: Variety Pack 2, Size: 16.5 fl oz (Pack of 4)
A must for my coffee station. Great taste and makes me miss a cafe latte a little less. Love the taste of all four.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
H
Verified Purchase
HT fanatic
Birmingham, US
★★★★★ 4
Ranked and reviewed by flavor
Flavor Name: Variety Pack 2, Size: 16.5 fl oz (Pack of 4)
Not using these syrups in coffee or drinks, just on muffins, breadsticks and ice cream. Here are the individual reviews from best to worst: -Caramel: almost perfect creamy pure caramel taste. Only flaw is I wish it were thicker. 9/10. -Dark Chocolate: has that classic slightly bittersweet dark countenance. You can almost taste a pleasant burnt cocoa bean flavor. Only flaw is that it is a bit too thick. 8/10. -Chocolate Caramel: not a perfect 50/50 blend, tastes more like a 70/30 blend in favor of caramel. Consistency is perfect, just the right thickness. 7/10. -White Chocolate: doesn't taste like WC whatsoever. It tastes like sickly sweet birthday cake icing in liquid form. Worst of all it is runny with no thcikness. 4/10.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products