SKU: 33677528311

LDLR(D193A) His Tag Protein, Human

Sale price$380.70 Regular price$423.00
Save 10%

Pay in installments of $105.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LDLR(D193A) His Tag Protein, HumanProduct Specification Species Human Synonyms FH, FHC, LDL R, LDL Receptor, LDLCQ2 Accession P01130 Amino Acid Sequence Ala22 Arg788(Asp193Ala), with C terminal 8*His

Product Specification


Species Human
Synonyms FH, FHC, LDL R, LDL Receptor, LDLCQ2
Accession P01130
Amino Acid Sequence

Ala22-Arg788(Asp193Ala), with C-terminal 8*His AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGASSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 110-120kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Nature Cell Biology volume 25, pages937-949 (2023)Cite this article.

Background

Low density lipoprotein (LDL) receptor also known as LDLR, FH, FHC, LDLCQ2 is a Mosaic protein that belongs to the low density lipoprotein receptor gene family. LDL receptors are translated by ribosomes on the endoplasmic reticulum and are modified by the Golgi apparatus before travelling in vesicles to the cell surface. LDL Receptor consists of 840 amino acids (after removal of signal peptide) and mediates the endocytosis of cholesterol-rich LDL. It is a cell-surface receptor that recognizes the apoprotein B100 which is embedded in the phospholipid outer layer of LDL particles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33677528311

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Interloper
Chelsea, US
★★★★★ 1
You Get What You Pay For! A Piece Of Junk!
Size: 1 Panel
Flimsy and a piece of junk. Don’t waste your money. Assembly is a pain because it is so flimsy. Divider is thin. You can see right through it. Very wobbly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
J
Verified Purchase
JAMES HAYES
Lexington, US
★★★★★ 4
Instructions are useless
Size: 1 Panel
The instructions are poorly written and not very helpful. The divider itself is easy to assemble, and honestly, it would’ve been quicker if I had skipped the directions altogether. Once put together, though, it works as intended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
P
Platinum Motif
Lexington, US
★★★★★ 5
This was the best
Size: 1 Panel
This divider is great for creating a little privacy or separating a small area without taking up much space. The fabric is thick enough to block visual clutter, and the frame is lightweight but stable once it’s opened. It folds flat for storage, which is convenient if you only need it occasionally. Assembly was straightforward, and it was the perfect size. It’s a practical piece for apartments, studios, or home offices where you want a quick, temporary partition.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
J
John M.
Pawtucket, US
★★★★★ 5
Good privacy screen
Size: 1 Panel, Size: 1 Panel
This is a good privacy screen that's easy to assemble and looks nice. Be a little careful moving it, as the corners can twist. It's sturdy once in place, and the thick material is completely opaque. If the folds bother you, you might want to iron it, but I'm happy with it as is.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
D
Dan & Stacey
Carnegie, US
★★★★★ 3
Lightweight divider that works well for video call backgrounds
Size: 1 Panel
This divider works fine for what it is, but it’s definitely on the lightweight side. Setup was very easy and only took a few minutes. The frame is fairly light, so it’s easy to move around or reposition if needed. That said, the tradeoff is that it’s not especially sturdy. It stands fine on its own but I wouldn’t expect it to handle much bumping or movement. I mainly bought it to use as a background for Zoom calls when I’m working from my den, and for that purpose it works great. The fabric panel blocks the room behind me and gives a cleaner background on camera. It’s not huge though. To keep the camera from seeing around it, I have to position it directly behind my chair. If you’re expecting it to divide a large room or create a big privacy barrier, it may feel a bit small. Overall, it does the job and works well for temporary setups or video call backgrounds, but the lightweight frame keeps it from feeling like a premium divider. The product description and photos are accurate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026

recommand products