SKU: 56511678995

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56511678995

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Ms R
Grantham, US
★★★★★ 5
Great for many ways on my leather goods!
Size: 16 Fl Oz (Pack of 1)
This stuff got the smell out of a purse I bought that had a chemical smell online. I mean, I try to wash this person all kinds of stuff and couldn't get the stink out of it. I thought I was gonna have to throw it out. I bought this at the last attempt to fix it and it got rid of the smell! I also used it on all my leather shoes, and I cleaned my leather headboard. All shiny and moist now. I know this is for cars, but I don't have any leather seats in my cars. But everything I used it on is clean and smells better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Keeping it clean!
Size: 32 Fl Oz (Pack of 1)
Great product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 5
The smell is wonderful
Size: 16 Fl Oz (Pack of 1)
This product smells really nice. Like clean fresh leather. My seats look nice. My dog had an accident all over the front of my seat and after cleaning thoroughly, this seemed to really help.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
B
Verified Purchase
Benjamin
Louisville, US
★★★★★ 4
Chemical Guys Leather Quick Detailer for Car Interiors 32oz
Size: 32 Fl Oz (Pack of 1)
Reliable Quick Cleaner for Leather Interiors I’ve been using the Chemical Guys Leather Quick Detailer on my car’s interior for a while now, and it’s become one of those go-to products I like to keep on hand. As the name suggests, this is designed for quick touch-ups rather than deep cleaning, and for that purpose, it really does the job well. The first thing I noticed is how easy it is to use. A couple of sprays on the leather seats or steering wheel, a quick wipe with a microfiber cloth, and the surface instantly looks cleaner. It removes light dust, dirt, and fingerprints in seconds. Unlike some products I’ve tried in the past, it doesn’t leave behind a slick or greasy feel, which is important when you’re dealing with things like a steering wheel or gear shifter that you’re constantly touching. Instead, the finish is clean, soft, and natural-looking, which is exactly what I want. The scent is another plus. It has a pleasant, subtle leather fragrance that makes the car smell fresh without being overwhelming or chemical-like. I don’t like products that leave behind a strong odor, and this one strikes the right balance. Another strength is its versatility. While it’s marketed as a car interior detailer, I’ve found it works well on other small leather items, like a laptop bag or even a chair at home. Obviously, it’s not a replacement for a full leather conditioner, but for light upkeep it’s nice to have a single product that can handle more than just my car. That said, there are a few things that keep this from being a perfect 5-star product. First, it’s definitely not designed for deep cleaning—if your leather is heavily soiled, stained, or dried out, this won’t be enough. You’d need a dedicated cleaner and conditioner for a full restoration. Second, the spray nozzle can be a bit inconsistent, sometimes giving off more of a stream than a fine mist. It’s not a huge issue, but it can waste product or make application less even if you’re not careful. Lastly, while it makes leather look clean and refreshed, it doesn’t provide as much conditioning as some other products, so if you’re looking for something that really nourishes and protects long term, this is more of a maintenance step than a solution. Overall, though, I’m very satisfied. The Chemical Guys Leather Quick Detailer is perfect for keeping leather looking sharp between major cleanings. It’s fast, effective, and leaves behind a clean finish without unwanted residue. It saves me time and keeps my car interior looking well cared for, which is exactly what I want from a quick detailer. I’d rate it 4 stars—an excellent product for regular maintenance and touch-ups, with just a few small shortcomings that prevent it from being the ultimate all-in-one leather care solution.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 9, 2025
R
Verified Purchase
Rebecca S
Pawtucket, US
★★★★★ 5
The smell is AMAZING!
Size: 16 Fl Oz (Pack of 1)
Our favorite cleaner and the smell is amazing!! Super functional and we use this on our leather couch too! Spray is nice and not too thick or watery. No stickiness or leftover residue. Instructions are clear and we will keep buying, it’s a great size and value for your money. You won’t regret it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026

recommand products