SKU: 4898290216

LILRB1/CD85j/ILT2 His Tag Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB1/CD85j/ILT2 His Tag Protein, HumanProduct Specification Species Human Accession Q8NHL6 Amino Acid Sequence Gly24 His458, with C terminal 8*His

Product Specification


Species Human
Accession Q8NHL6
Amino Acid Sequence Gly24-His458, with C-terminal 8*His GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHHHHHHHHH
Expression System HEK293
Molecular Weight 58-82kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS PH7.4
Reconstitution Reconstitute at 0.1-1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B1 (LILRB1) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85j, ILT2, LIR1, and MIR7, contains four extracellular immunoglobulin domains, and four intracellular ITIMs. It is expressed on monocytes, macrophages, DCs, eosinophils and basophils, mB cells, T cells, and natural killer (NK) cells, as well as on in vitro cultured cord blood-derived progenitor mast cells and osteoclasts. LILRB1 and HLA-I molecule interactions are dependent on the non-polymorphic α3 domain of the heavy chain and β2 microglobulin. LILRB1 additionally interacts with the UL18 molecules from human cytomegalovirus (HCMV), which is an HLA-I homolog, RIFIN molecules from Plasmodium falciparum, Dengue virus through an unidentified ligand, and the damage associated molecular pattern proteins S100A8 and S100A9. Recent studies suggest that LILRB1 on tumor cells stimulates immune responses in certain situations.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4898290216

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jessica Blevins
Omaha, US
★★★★★ 5
Light weight and fit well
Size: 3X-Large Big Tall, Color: Sapphire Blue‌
Great fit and feel!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
R
Verified Purchase
rms
Los Angeles, US
★★★★★ 5
Nice shirt, great price.
Fit Type: Regular Fit, Color: White, Size: Medium
Worn it twice and I find it very comfortable. I wear it outside and casually to protect my arms and neck from the sun and find it more comfortable than a long sleeve t-shirt. The price is comparable. If I was to wear it to the office it would have to be ironed. I bought one shirt to try it and I will be buying more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
M
Verified Purchase
madison
Battle Creek, US
★★★★★ 5
nice quality
Fit Type: Regular Fit, Color: White, Size: Small
nice quality shirt. bought this just so i had at least one nice white button down and it's great. fits well and is a nice white color.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
A
Verified Purchase
Anthony Carabello
Boise, US
★★★★★ 4
Nice shirt!
Fit Type: Regular Fit, Color: White, Size: X-Large
I added one of these shirts to another order just to see if they were any good. I was pleasantly surprised by the quality. It fits perfectly and looks pretty nice for a low cost casual dress shirt. Materials seem decent quality. Comfortable, soft fabric. Didn’t shrink too much in the washer and dryer. We’ll see how it holds up long term but so far so good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2025
S
Verified Purchase
Silvia & Marcus
Lake Worth, US
★★★★★ 5
My new favorite shirts!
Fit Type: Regular Fit, Color: Grey, Size: Large
These are my new favorite shirts! I just ordered a 3rd. i wish there were more colors. Yes, the cotton is heavy-weight and I like that. They are just a bit warmer than regular dress shirts. The fit is excellent. I'm 5'9", 200lbs and L fits perfectly. Enough room without being blousy. The sleeves are long enough (finally!). (Most other 16.5/32-33 shirts always have sleeves that are too short). The fit/finish and detail is surprisingly good. They don't really shrink after washing and come out very soft. Not wrinkle-free, but that's ok since it means that the 100% cotton hasn't been dosed with chemicals. I expect they will wear very well over time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2025

recommand products