SKU: 53247038944

Human ADAM23 Protein, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 21 - Sep 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ADAM23 Protein, His tagProduct Specification Species Human Synonyms Disintegrin and metalloproteinase domain containing protein 23, ADAM 23, Metalloproteinase like, disintegrin like, and cysteine rich protein 3 (MDC 3), MDC3 Accession O75077 Amino Acid Sequence Protein sequence (O75077, Ser60 His585, with C His tag)

Product Specification


Species Human
Synonyms Disintegrin and metalloproteinase domain-containing protein 23, ADAM 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 (MDC-3), MDC3
Accession O75077
Amino Acid Sequence

Protein sequence (O75077, Ser60-His585, with C-His tag) SRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLH

Expression System HEK293
Molecular Weight Predicted MW: 61.2 kDa (pro) & 34.9 kDa (mature) Observed MW: 40-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

ADAM23 (A Disintegrin And Metalloproteinase 23) is a member of the ADAM family, known for its roles in cell adhesion and signaling. Unlike other ADAMs, it lacks proteolytic activity but interacts with integrins and extracellular matrix proteins, influencing neuronal development and synaptic plasticity. ADAM23 is highly expressed in the brain and has been linked to epilepsy and neurodegenerative disorders. It also plays a role in cancer progression, where its dysregulation affects tumor cell migration and metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53247038944

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kelly
Carnegie, US
★★★★★ 2
Charger portion stopped working twice now
Works well until it doesn't. Was excited to get the phone mount off the car vent but I have gone through one replacement already and now I'm past the point to completely return it. Twice now the charging portion has failed. The first one stopped lighting up completely with in about a week and now this one just constantly flashes and no longer charges after another few weeks. I have tried different cords and outlets in my car with no success. The magnet portion however is strong and does hold the phone well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
A
Verified Purchase
Amazon Customer
Bozeman, US
★★★★★ 1
Do not buy this junk... it will damage your car!
This junk broke my dash!!! See pictures
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2025
M
MNPJACC
Lexington, US
★★★★★ 5
Perfect for every day use
The Wincar Magnetic Wireless Phone Mount and Charger is a thoughtfully designed accessory tailored for Toyota 4Runner models from 2010 to the present, and it also fits well with other vehicles using a 17mm ball mount base. The package includes a sturdy mount, a 15W magnetic wireless charger, a charging cable, and two steel rings. These steel rings are particularly useful for those who do not own a MagSafe-compatible phone or case, ensuring broader compatibility.  I specifically purchased this charger and holder to use with my existing 17mm ball mount base, which I found challenging to match with most other products—especially for my Lexus GX460. While there are many phone holders on the market, very few offer the dual functionality of both MagSafe mounting and wireless charging in one unit. This all-in-one solution eliminates the need for multiple accessories, but it’s important to note that the charger /mount  require a power connection to operate.  In terms of performance, the Wincar mount and charger deliver impressively. When connected to a reliable USB-C charging source or a USB-C cigarette lighter adapter, the magnetic grip is strong, keeping the phone securely in place even during bumpy rides. The wireless charging is efficient, providing a reasonably fast charge without overheating or lag. The magnetic force is particularly robust, ensuring that the phone remains stable and aligned for optimal charging.  Overall, this mount and charger combination offers a seamless, convenient experience for anyone seeking a reliable phone holder and charger for their vehicle. For my needs, it has proven to be both practical and effective.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2025
B
BLACK GLOVE UNBOXING
Grantham, US
★★★★★ 5
A Solid Mount with Minor Imperfections
This MagSafe mount is a fantastic addition to my 2024 4Runner, offering a nearly factory-fit look. Installation was straightforward, though it required a bit of nerve. I was worried the clips attaching to the AC vent would snap, but with firm, steady pressure, they clicked securely into place without any issue. The result is a very stable platform for my phone. Functionally, it performs exactly as hoped. It supports fast charging when paired with a capable cigarette port adapter, and the magnetic connection is surprisingly strong. It holds my heavy S25 Ultra securely during daily commutes, and the inclusion of two metal rings for non-MagSafe cases is a thoughtful touch. I haven't tested its limits on a bumpy off-road trail, but for normal driving, it’s perfect. My only two critiques are minor but worth noting. With the phone in place, it completely blocks the hazard light button. A slight inconvenience. Additionally, I wish the mount's color matched the silver trim around the infotainment system for a more seamless look. Despite these small flaws, it's an excellent, clean mounting solution that I would recommend to other 4Runner owners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2025
Z
Verified Purchase
Zach
Chelsea, US
★★★★★ 5
Five Stars — Finally Got My Charger Back!
Color: Black, Color: Black
I bought this 3-in-1 wireless charging station as a gift for my girlfriend so she would finally stop stealing mine — and let me tell you, it worked. She loves it, her devices love it, and I love not having to play “Where’s my charger?” every night like it’s some kind of relationship scavenger hunt. Pros: • MagSafe is strong — Her phone snaps on like it’s reconnecting with its soulmate. • Charges iPhone, Apple Watch, and AirPods all at once — AKA: no more tangled octopus of cables on the nightstand. • Looks clean and modern — Her side of the room instantly leveled up in aesthetics. • Fast charging — She swears her phone charges “faster than her attitude in the morning,” her words not mine. Cons: • Now she judges my setup — Apparently I’m the one with the “messy” charger now. • Might make you buy a second one — Because the moment you try to use hers, she suddenly remembers boundaries. Overall, great gift, works perfectly, and saved my sanity. Would 100% buy again — but I don’t have to, because she finally stopped borrowing mine!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025

recommand products