SKU: 47927514939

LOX-1/OLR1 His Tag Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LOX-1/OLR1 His Tag Protein, HumanProduct Specification Species Human Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR E1 Accession P78380 Amino Acid Sequence Ser61 Gln273, with N terminal 9*His HHHHHHHHHSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ Expression System HEK293 Molecular Weight 30 40kDa (Reducing) Purity 95%

Product Specification


Species Human
Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR-E1
Accession P78380
Amino Acid Sequence

Ser61-Gln273, with N-terminal 9*His

HHHHHHHHHSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Expression System HEK293
Molecular Weight 30-40kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sawamura, T. et al. (1997) Nature 386:73.

2.Daugherty, A. et al. (2000) Curr. Opin. Cardiovasc. Pulm. Ren. Invest. Drugs. 2:223.

3.Platt, N. and S. Gordon (2001) J. Clin. Invest. 108:649.

4. Platt, N. and S. Gordon (1998) Chem. Biol. 5:R193.

Background

Lectin-like oxidized low-density-lipoprotein receptor-1 (LOX-1), also known as oxidized low-density-lipoprotein receptor-1 (OLR-1), is a type II transmembrane receptor belonging to the C-type lectin family. It also belongs to the functionally defined scavenger receptor (SR) superfamily, whose members share the common ability to bind and internalize modified forms of Low Density Lipoproteins (LDL). LOX-1 is the first member of the class E scavenger receptor subfamily (SR-E). It binds and supports the internalization of multiple structurally unrelated macromolecules including oxidized LDL, advanced glycation end products (AGE), activated platelets, bacteria, apoptotic or aged cells, and heat shock proteins. LOX-1 has also been implicated as an intestinal receptor involved in the transcytosis of pancreatic bile salt-dependent lipase. The human LOX-1 gene encodes a 273 amino acid (aa) residue protein with a short N-terminal intracellular domain, a transmembrane domain, an extracellular stalk/neck region followed by a C-type lectin-like domain (CTLD). The CTLD, which is required for ligand recognition, contains the six conserved cysteine residues present in all C-type lectins, but lacks the Ca2+-binding residues found in classical C-type lectins. LOX-1 can be detected on activated endothelial cells, vascular smooth muscle cells, macrophages, intestinal cells and dendritic cells. The expression of LOX-1 is induced by proinflammatory or proatherogenic stimuli, as well as by oxidized LDL itself and hemodynamic or oxidative stress. Human LOX-1 exists on the cell surface as covalent homodimers, which can further associate into non-covalent-linked oligomers. Cell surface LOX-1 can also be cleaved by yet unidentified proteases to release the soluble LOX-1 extracellular domain. Binding and endocytosis of oxidized LDL by LOX-1 induces oxidative stress, activates NF kappa B,  and upregulates the expression of monocyte chemoattractant protein-1 and matrix metalloproteases. LOX-1-dependent oxidized LDL uptake also induces apoptosis by inducing the expression of the pro-apoptotic Bax and downregulation of the anti-apoptotic Bcl-2.  Oxidized LDL plays a key role in the pathogenesis of atherosclerosis and endothelial dysfunction. Blockade of LOX-1 functions may turn out to be a suitable target for the therapeutic intervention of atherosclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47927514939

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Joshua Jordan
Lexington, US
★★★★★ 5
It's simple, it works, & its price makes for a good deal
Size: Single, Style: Free-Standing
I needed a stand for a 27" VIZIO TV that had been wall-mounted for a few years, & (?) the original stand must've got the toss long ago... It's hard to say... I found this stand on Amazon priced right, plus it had a coupon attached to the listing. I scrolled down & I saw a "newer model" of the same product was available, so I was initially hesitant. But, looking at the product pictures, reading the description, & scanning through some of the reviews, then the same with the "newer model" — the only difference I could see was mostly aesthetic (it also appears to have a desk mount included, which wouldn't have worked for me regardless of its purpose—either for conversion to a desk stand-off mount, or to further secure the stand....?) Eventually, I just thought "....it's a stand with a VESA mount; how do you **** that up...?" And I really couldn't think of anything...even if the VESA bracket was milled not to spec (it is milled to spec), I could have still made it work....(?) So, I made the purchase, received it, & 9-10 screws later, the TV had a stand. & I'm guessing a much more versatile stand than the original. The bracket that attaches the stand to the VESA mount can lower or raise the TV quite a bit. Even in it's highest position, it's still retains its sturdiness & remains stable. The baseplate has a decent amount of weight, and its overall design is well balanced to favor stability (to a tolerance; e.g., an old CRT monitor just isn't going to work). The stand is literally 4 basic pieces—the VESA bracket, an articulating bracket, a metal tube, & a metal baseplate. If you have a standard phillips screwdriver, then the stand is easy to assemble. If you have any experience with TV mounts, or TV stands, then it assembles in less than 15 minutes. Given what you get for the price, the ease of assembly, the added versatility, if you need a stand for a screen within the manufacturer's specific tolerances, then I would absolutely recommend this stand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2021
V
Verified Purchase
viplarry
Whiting, US
★★★★★ 5
Decent Monitor Stand with Some Assembly Required
Size: Single, Style: Free-Standing
This monitor stand works pretty well and is a good value for the price. It’s sturdy and adjustable, which makes it perfect for a variety of monitors, including my 32-inch curved Samsung. The assembly is straightforward if you have a Phillips screwdriver and something to tighten bolts, like a wrench. It’s solid once it’s put together and holds my monitor securely. The phone holder could use some improvement. It doesn't adjust to face me directly, which is a bit annoying. The stand itself is great for saving desk space and providing better ergonomics, but it can be a bit of a hassle to assemble if you’re not handy with tools. Overall, a good buy if you need a reliable monitor stand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2024
S
Verified Purchase
sirav
Charlottesville, US
★★★★★ 3
Works, Good product, but wouldn't recommend for specifically 3 27inch screens.
Size: Triple, Style: Free-Standing
I purchased this stand to have 3 27inch 2560x1440 monitors, with the side ones angled towards me in a typical 3-monitor setup often seen being used by racing or aviation simulator guys. This stand's arms for the two side monitors are not long enough to have said monitors angled more than 5 to 8 degrees meaning they are forced to be completely linear which is incredibly awkward to try to use because you can barely see or use the screen space on the far edges. 𝐖𝐢𝐭𝐡 𝐭𝐡𝐞𝐬𝐞 𝐬𝐢𝐳𝐞 𝐬𝐜𝐫𝐞𝐞𝐧𝐬, 𝐭𝐡𝐞 𝐨𝐧𝐥𝐲 𝐰𝐚𝐲 𝐭𝐨 𝐡𝐚𝐯𝐞 𝐞𝐯𝐞𝐧 𝐨𝐧𝐞 𝐚𝐭 𝐚𝐧 𝐚𝐝𝐞𝐪𝐮𝐚𝐭𝐞 𝐚𝐧𝐠𝐥𝐞 𝐟𝐨𝐫𝐜𝐞𝐬 𝐭𝐡𝐞 𝐨𝐭𝐡𝐞𝐫 𝐦𝐨𝐧𝐢𝐭𝐨𝐫 𝐭𝐨 𝐛𝐞 𝐢𝐧 𝐩𝐨𝐫𝐭𝐫𝐚𝐢𝐭 𝐦𝐨𝐝𝐞, 𝐤𝐢𝐧𝐝 𝐨𝐟 𝐦𝐞𝐬𝐬𝐢𝐧𝐠 𝐮𝐩 𝐭𝐡𝐞 𝐰𝐡𝐨𝐥𝐞 𝐩𝐨𝐢𝐧𝐭 𝐨𝐟 𝐛𝐮𝐲𝐢𝐧𝐠 𝐭𝐡𝐢𝐬. The product description should not say it can hold 3 27 inch screens because the amount of struggling I had to do to get it to be acceptable was ridiculous. The stand is... not heavy enough to safely hold monitors of this size either, and additional weight was required ( 2 10lb dumbbells in my case ) configuring the height of your monitors with this stand can be dangerous as well as they could fall down the central post so you have to be extremely careful, but, it is pretty easy other than that. It is a great option if you don't have a desk with an edge for typical stands ( I don't. ) You can place the stand anywhere, and you don't have to drill through your desk if you really don't want to. The cable clips are a very nice included bonus, and they sent me a replacement without any hassle when I totally effed up my first attempt at setup. But, I would have shopped harder and got something else if I knew all this prior all the same. Maybe even bought a gigantic curved screen instead.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2025
D
Verified Purchase
Dr. Dean
Natrona Heights, US
★★★★★ 5
Everyone likes the extra outlets and spacing!
Size: 6ft, Color: Yellow
I have a livestream desk shared by a team where we have lots of equipment. We were always running out of outlets and the team had nothing but praise when I installed this 16 outlet replacement. The spacing is perfect for a variety of bricks, plugs and adapters of all sizes. It's metal construction seems very durable and it's easily to mount it solidly to the wall with the wings at each end. The power cord is sufficiently beefy and lighted switch at one end a plus. Overall, we're very happy with its design, capability and value. The extra praise for doing a simple replacement was nice too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
J
Verified Purchase
Joseph Espi
Natrona Heights, US
★★★★★ 5
Heavy-Duty Power for Any Workshop or Garage
Size: 6ft, Color: Yellow
I recently upgraded my workspace with the JUNNUJ 16-Outlet Heavy Duty Power Strip, and it has completely transformed how I manage tools and electronics in my garage. Why It Stands Out: Ample Outlets With 16 wide-spaced outlets, it accommodates bulky plugs, adapters, and chargers without blocking neighboring sockets. Perfect for workshops or garages where multiple tools run simultaneously. Durable Construction The full metal housing gives it an industrial-grade feel, and it can handle heavy-duty equipment without bending or warping. Unlike plastic strips, this one feels built to last. Safety First Equipped with surge protection and grounded outlets, it keeps both tools and electronics safe. I feel confident plugging in expensive power tools or charging devices without worrying about power spikes. Practical Length The long cord allows me to reach multiple corners of my garage without needing extension cords, reducing clutter and tripping hazards. Professional-Grade Design Wide-spaced, high-capacity, and metal-built — this is clearly designed for industrial or garage use, not just casual household tasks. It’s heavy-duty without being overcomplicated. Minor Considerations: It’s larger and heavier than standard power strips, so it needs a stable mounting spot or surface. Price is higher than a typical household strip, but for the durability and outlet capacity, it’s worth it. Bottom Line: The JUNNUJ 16-Outlet Heavy Duty Power Strip is a powerhouse for garages, workshops, or any space with multiple high-demand devices. Durable, safe, and highly practical, it’s a must-have for anyone who needs reliable industrial-grade power management.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025

recommand products