Pay in installments of $87.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 21 - Aug 26
For Your Every Summer RSVP, with Code: SUMMER15
Description
MDL-1 /CLEC5A His Tag Protein, HumanProduct Specification Species Human Synonyms CLEC5A Accession Q9NY25 Amino Acid Sequence Pro 28 Lys188,with N terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK Expression System HEK293 Molecular Weight 33 45 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | CLEC5A |
| Accession | Q9NY25 |
| Amino Acid Sequence | Pro 28-Lys188,with N-terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK |
| Expression System | HEK293 |
| Molecular Weight | 33-45 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
CLEC5A is a spleen tyrosine kinase (Syk)-coupled C-type lectin that is highly expressed by monocytes, macrophages, neutrophils, and dendritic cells and interacts with virions directly, via terminal fucose and mannose moieties of viral glycans. CLEC5A also binds to N-acetyl glucosamine(GlcNAc) and N-acetylmuramic acid(MurNAc) disaccharides of bacterial cell walls. Compared to other C-type lectins(DC-SIGN and DC-SIGNR) and TLRs, CLEC5A binds its ligands with relatively low affinities. However, CLEC5A forms a multivalent hetero-complex with DC-SIGN and other C-type lectins upon engagement with ligands, and thereby mediates microbe-induced inflammatory responses via activation of Syk. For example, in vivo studies in mouse models have demonstrated that CLEC5A is responsible for flaviviruses-induced hemorrhagic shock and neuroinflammation, and a CLEC5A polymorphism in humans is associated with disease severity following infection with dengue virus. In addition, CLEC5A is co-activated with TLR2 by Listeria and Staphylococcus. Furthermore, CLEC5A-postive myeloid cells are responsible for Concanavilin A-induced aseptic inflammatory reactions. Thus, CLEC5A is apromis-Cuous pattern recognition receptor in myeloid cells and is a potential therapeutic target for attenuation of both septic and aseptic inflammatory reactions.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 9 reviews
Sort
Product Reviews
★★★★★ 1
Used shoes
Size: 10 Little Kid, Color: Glitter Clear W/Strap, Size: 10 Little Kid, Color: Glitter Clear W/Strap
If I could give this zero stars, I absolutely would. I ordered these shoes expecting them to be brand new since I paid full price and never selected any “used” option. What I received instead were clearly heavily worn shoes there were visible signs of use that you simply wouldn’t expect from a new product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
★★★★★ 5
Pricey but worth it
To say my daughter loves shoes would be an understatement and whenever you throw in a fun color and glitter to the mix, it only exponentially increases the love and excitement every time she puts on these shoes! The quality of the shoes are outstanding, they provide support in the right places and so far have been surprisingly durable (for a toddler that’s saying something)! This is the second pair of this shoe that I’ve purchased, the first was a pair of the clear glitter style. They are very cute shoes and the color matched the pictured on the website very well, which was great since I was trying to complete a “Princess Anna” look with a previously purchased dress. Note: I do suggest to size up one size, because in my experience they run a little small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 2, 2024
★★★★★ 5
My daughters favorite shoe!
Size: 10 Little Kid, Color: Gold W/Strap
My daughter wears these every single year- we always get the gold and clear glitter. They go with everything and so comfortable to her. Once it gets warm outside this is her go to shoe everyday!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2024
★★★★★ 5
My fav
Size: 10 Little Kid, Color: Rose Glitter W/Strap
My daughters have had have these campana shoes in every size and every color, i love them and they do too, they are light, comfy and cute
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2024
★★★★★ 1
Arrived used for the second time.
Size: 10 Little Kid, Color: Rose Glitter W/Strap
I love Melissa sandals. The product is good, but it arrived used for the second time. It is poor store management.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026