Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 19 - Jul 24
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LRP10 His Tag Protein, MouseProduct Specification Species Mouse Synonyms LRP10, LRP9, MST087, MSTP087 Accession Q7TQH7 Amino Acid Sequence Arg18 Lys441, with C terminal 10* His
Product Specification
| Species | Mouse |
| Synonyms | LRP10, LRP9, MST087, MSTP087 |
| Accession | Q7TQH7 |
| Amino Acid Sequence | Arg18-Lys441, with C-terminal 10* His RPDRITFPRSACEAPPAVLSEVQGTLQRPLGRDSRSSPANCTWVILGSKDQTVTVRFQKLHLACGSEHLILHSPLQPPISLCEAPSGPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCSSDPFPNLNPAPAPTLACNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLSYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSSGRGFNATYHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHFPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCTDGSDEWDCSYALPRKGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 56-61kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Jeong Y H. et al. (2010) The low-density lipoprotein receptor-related protein 10 is a negative regulator of the canonical Wnt/beta-catenin signaling pathway. Biochem Biophys Res Commun. 392(4): 495-499. 2、Beisiegel U. et al. (1991) Lipoprotein lipase enhances the binding of chylomicrons to low density lipoprotein receptor-related protein. Proc Natl Acad Sci U S A. 88(19): 8342-8346. 3、Strickland D K. et al. (1990) Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor. J Biol Chem. 265(29): 17401-17404. |
Background
Human LDLR-related protein 10 (LRP10, called LRP9 in mice) is a member of a new subfamily of LDLR that includes two other receptors, LRP3 and LRP12. This unique subfamily of LDLR is characterized by extracellular CUB domains and large cytoplasmic tails containing acidic dileucine (DXXLL) motifs. LRP10 is expressed in various tissues (including the brain), and is localized in the TGN and endosomes. It is reported that LRP10 is a functional amyloid precursor protein (APP) receptor involved in APP trafficking and processing. Some studies have suggested a role of LRP10 in ligand trafficking between the trans-Golgi network, endosomes, and the plasma membrane. Recently, LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. Moreover, LRP10 variants have been found in individuals diagnosed with progressive supranuclear palsy and amyotrophic lateral sclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 5
Most Elegant Buy
Item Package Quantity: 2
Perfect, beautiful designs. Room submerges in colors. Easily installation, plug in and download app. Works perfectly -programs easy. Most compatible to the app.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2025
★★★★★ 5
Outstanding TV backlight edition
Item Package Quantity: 2, Item Package Quantity: 2
This is an excellent addition to a TV backlight. If you go into the GOVEE app you can sync this device to a TV backlight with a camera. You can add up to five lights.
I recommend this for either a TV backlight or general ambience in the room at night.
UPDATE 2025: I actually have 4 of these.
3 of them I synced with the TV strip light/camera using the GOVEE app for TV watching.
The 4th one I use is on ambience lamp.
These are made very durable/easy to set up. These things are not cheaply made
I highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2025
★★★★★ 5
Look nice and were an easy setup.
Item Package Quantity: 2
Simple and do what they are supposed to do. I use them to add a bit of flare to my desktop setup for online meetings, etc. If I had to nitpick, I'd say cabling is always interesting to route to reduce desk clutter, but I am not going to remove a star for what pretty much has to be. They look nice too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
★★★★★ 3
Good, but missing white (ww) hues hurt performance
Item Package Quantity: 2, Item Package Quantity: 2
I bought these lights just a little over a year ago, and overall I’m pleased with them. I bought them because standard strip lighting does not work well with the shape of my ultra flat TV, something I did not consider on purchasing the TV.
The lighting effects that these can produce are really impressive, at times you can see what appears to be the individual LEDs and the effects are somewhat more granular or pixelated than other lights from GOVEE.
The issue I have with these lights is that they are not able to produce cool, white and warm white, and they do not render colors like other bulbs from GOVEE. Colors on these lights tend to be brighter than every other light source I have from Govee, including their lightbulbs and their floor lamps. Although I knew about the white rendering, I did not realize how annoying it would be to see warm, white and cool, white rendered poorly on these TV lights. If you want to truly seamless and integrated looking product, I suggest you look elsewhere as these aren’t quite there. If you don’t care or are using these in a room where you don’t have any other light sources from Govee, then go for it — you’ll love them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2025
★★★★★ 5
Stylish way to stay organized!
Color: Black
This tray is a perfect way to keep your everyday items organized and easy to find when you are getting ready for your day. No more wondering where you've put your keys, your glasses, your wallet, your watch or your every day wear jewelry like your wedding ring (if you have to remove it at night due to hands swelling or similar). This tray allows my husband to be ready to go quickly if we decide to spontaneously go somewhere. Its compact enough to fit on a night stand or a dresser, but still provides adequate spaces for your every day pocket items like a multi-tool or pocket knife, spare change, etc. Its well made and stylish too. I am very pleased with this purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025
recommand products
SHOWER CHANNEL BASE 900MM LT W/O TOP - AQUANT - (304 STAINLESS STEEL - - 0x0 mm - 0inchX0inch)
2000.00
NTR - Netsuzou Trap Vol. 1
83.00
TABLE MOUNTED CERAMIC WASH BASIN - AQUANT - (MATT BLACK - - 815x410 mm - 32.6nchX16.4inch)
12600.00
A Beast's Descent Into Love
90.00
HONE-SL BASIN MIXER TALL W/PIPES - KOHLER PREMIUM - ( POLISHED CHROME - PREMIUM - 0x15 mm - 0inchX0.5inch )
4158.00