SKU: 56733472232

C1qR1/CD93 His Tag Protein, Human

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 19 - Jul 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

C1qR1/CD93 His Tag Protein, HumanProduct Specification Species Human Synonyms C1q MBL SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix remodeling associated protein 4 Accession Q9NPY3 Amino Acid Sequence Thr22 Lys580, with C terminal 8*His

Product Specification


Species Human
Synonyms C1q/MBL/SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4
Accession Q9NPY3
Amino Acid Sequence Thr22-Lys580, with C-terminal 8*His TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 88-95kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Greenlee-Wacker M C. et al. (2011) Membrane-Associated CD93 Regulates Leukocyte Migration and C1q-Hemolytic Activity during Murine Peritonitis. J. Immunol. 187: 3353-3361.

2、Nepomuceno R R. et al. (1997) cDNA cloning and primary structure analysis of C1qRp, the human C1q/MBL/SPA receptor that mediates enhanced phagocytosis in vitro. Immunity. 6: 119-129.

3、Nepomuceno R R. et al. (1998) C1qRp, the C1q receptor that enhances phagocytosis, is detected specifically in human cells of myeloid lineage, endothelial cells, and platelets. J. Immunol. 160: 1929-1935.

Background

Complement component 1q (C1q) receptor 1 (C1qR1, also known as C1qRp, or cluster of differentiation 93-CD93) is a 126-kDa type 1 transmembrane glycoprotein expressed in endothelial and hematopoietic cells, and responsible for C1q-induced phagocytosis. CD93 contains one C-type lectin domain and five EGF-like domains. Mature human CD93 consists of a 557 amino acid (aa) extracellular domain (ECD) with one C‑type lectin domain, four tandem EGF‑like domains, and a mucin‑like domain, followed by a 21 aa transmembrane segment and a 51 aa cytoplasmic domain. CD93 is receptor for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). Soluble CD93 promotes the differentiation of monocytes to macrophages, phagocytosis of apoptotic cells, and inflammatory responsiveness to multiple TLR ligands.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56733472232

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
M.R.
Charlottesville, US
★★★★★ 5
No more painful cracked heels! These really do work!
Material Type: Black - 3 Pairs, Size: X-Large
These really do work well. This is one of the first winters that I have not experienced painful, cracked heels. They are long lasting, and definitely make my heels smoother and softer after wearing them. For the first few times wearing them I simply went with the moisturizer embedded in them. After a few uses I then covered my heels with Aquaphor Advanced Therapy Healing Ointment. This worked even better, and I would recommend it. I am very glad I bought these. Of note, I have really big feet that are quite wide and the XL are a little snug but not uncomfortably so. I use them overnight, but also have worn them under socks and they work fine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
T
Verified Purchase
Tammy James
Pawtucket, US
★★★★★ 5
HEALTH & BEAUTY
Flavor Name: XL silicone socks 2 pairs
LOVE IT
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
B
Verified Purchase
Barb W
Grantham, US
★★★★★ 3
Stains easily. Tight for men's size 11 feet
Flavor Name: XL silicone socks 2 pairs, Flavor Name: XL silicone socks 2 pairs
Husband wore dark cotton socks over these gel foot covers overnight and the covers picked up color from the socks. Tried hand washing, even dabbing with a bleach soaked paper towel, but the stains remained. The covers are a bit tight for men's size 11. Edit: After a few more hand washings the stains began to fade. However one tore around the leg opening when taking it off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2024
D
Verified Purchase
DD
Fort Morgan, US
★★★★★ 1
Worthless. Tore on first use.
Flavor Name: XL silicone socks 2 pairs
The first time I put these on my feet, the whole toe broke right through. They were a proper fit and my feet are well pedicured. Just very poor quality. I don’t recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 2, 2024
P
Verified Purchase
Pat Belanger
Birmingham, US
★★★★★ 5
Best fit!
Flavor Name: XL silicone socks 2 pairs
Search no further, these are the BEST! They are smazing at conforming to the shape of your feet. They fit snuggly with no sags/bags or uncomfortable pressure or squeezing of your toes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2025

recommand products