Pay in installments of $75.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRB3/CD85a/ILT5 His Tag Protein, HumanProduct Specification Species Human Accession O75022 Amino Acid Sequence Gly24 Glu443, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | O75022 |
| Amino Acid Sequence | Gly24-Glu443, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-75kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
LILRB3 is a member of LILRB family that is restrictively expressed on myeloid cells, including monocytes, neutrophils, eosinophils, and basophils (as well as on in vitro differentiated mast cells and osteoclasts). LILRB3 contains four cytoplasmic ITIM motifs hat may contribute to negative regulation of immune response. Ligation of LILRB3 in human myeloid cells led to inhibition of immune activation. LILRB3 may be an inhibitor of allergic inflammation and autoimmunity. However, the ligand for LILRB3 has not been identified, and the downstream signaling of LILRB3 is unclear. It is noteworthy that LILRBs, including LILRB3, are primate specific.
LILRB3 is also expressed on some myeloid leukemia, B lymphoid leukemia, and myeloma cells. It is reportedly co-expressed with stem cell marker CD34 and with myeloma marker CD138.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 18 reviews
Sort
Product Reviews
★★★★★ 5
Best. Toy. Ever. For My Superchewer!
Size: Large, Color: Skinny Green, Size: Large, Color: Skinny Green
Best toy ever! My dog destroys toys. Usually within about 15 minutes, she has de-squeakered and defluffed them. By the second day, she has tug-of-war-ed them to shreds.
From the time we got this adorable dragon out of the package, she LOVED it. She set to work. It’s been a week, and while she has dewinged him, he lost his squeaker after a few days, and he looks a bit rough, he’s still in one piece! And, we’ve had HOURS of tug-of-war with minimal rips! She’s obsessed 😍 I ordered two more today. We’ve finally found the perfect toy for my baby!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
★★★★★ 5
My 90 lb. Pitbull's All-Time Fave Toy
Size: Large, Color: Coral, Size: Large, Color: Coral
I ordered a plethora of new toys for Bruce to keep him occupied while I am working remotely from home. Poor guy gets so bored while I'm stuck in front of my computer 8+ hours a day. All the other toys are animated, but this one is just a big floppy chewy squeaky toy. Bruce quickly lost interest in all the other chirping, hopping, and twirling toys and fell in love with "Diny". When I opened Diny and gave it to Bruce, he had the elated and surprised look of a 3 yr old at Christmas. And he stayed that happy for hours, and then each time he picked up Diny to play. Diny became his go-to toy over all others (and there are many!). It is well made out of durable fabric, and they did not stuff it full of kapoc (I hate kapoc in dogs toys!). And it is delightfully low-tech. Normally he tears a squeaky toy apart as soon as he can isolate the squeaky mechanism. But cleverly, the squeaky box is loose in the long belly so it moves from one end to the other as the toy is handled. That made it difficult for Bruce to locate it. The toy remained in good condition for 2 weeks of near constant attention by Bruce. But yesterday he zeroed in on the squeaky box and ripped Diny to shreds. I was sad to see Diny go so soon. But boy-howdy was Bruce happy with it. I'm gonna buy another because we liked it so much. And so did I : )
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2024
★★★★★ 5
This is one “under the radar” gem!!
Size: Large, Color: Coral
This is one “under the radar” gem!! Very strong internal squeaker and way tougher than it looks. My big 125lb Shepard-Husky mix gave it heck, then made it his new buddy. He’ll occasionally give it the business but on the whole, it’s surprisingly tough and my big boy loves it. Nice price!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
★★★★★ 4
Cute but small
Size: Large, Color: Skinny Green
Cute stuffy and has not yet ripped. While my dogs plays with it, the toy is a bit small for him. For reference he is 120lbs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
★★★★★ 5
A Must-Have for Toy-Loving Pups!
My Frenchie is obsessed with this Pawatoga bottle toy! The design is adorable and such a fun twist, but what impressed me most is how durable it’s been. He’s been chewing, tossing, and carrying it around non-stop, and it’s still holding up perfectly.
The plush exterior is soft enough for him to snuggle, but the construction is sturdy enough to survive his play sessions. Bonus points for how easy it is to clean and how cute it looks when he’s “sipping” from it!
If your dog loves plush toys but you’re tired of them falling apart in a day, this one’s definitely worth it. Stylish, tough, and totally pup-approved.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 14, 2025
recommand products
Towtrust Fixed Flange Towbar + Towball and 13P Univ. Wiring For Audi A4 Estate 2005 To 2008
150.19
Solitaire F22002P Strappy Back Plain, Youth
117.49
Solitaire F22007P Sweetheart Plain
112.86
Solitaire F22002R Strappy Back Lightly Rhinestoned
159.99
Towtrust Fixed Flange Towbar + Towball and 13P Univ. Wiring For Audi A6 Estate 2005 To 2011
154.38