Pay in installments of $56.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 27 - Sep 1
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP8 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | Fatty acid binding protein 8, P2, PMP2 |
| Accession | P02689 |
| Amino Acid Sequence | Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
| Expression System | E.coli |
| Molecular Weight | 18kDa (Reducing) |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 12 reviews
Sort
Product Reviews
★★★★★ 5
Covers lots of important topics
Format: Kindle
12 Universal Skills by Peter Scheele and Nina Bech-Andersen is one of those books that comes across as something that should be taught in a college level classroom. If I was going to rename the book, I would call it How to Work With People. This is a general skill that we never really learn much about, but so much of our lives both professionally and personally are based around this idea. Some of the topics included here are how to solve conflicts with others, how to manage your time, and how to work as part of a team. These are skills that we are expected to practice as we make our way through school, but are never truly taught to us making them areas of weakness that need to be addressed. If you are starting a career, just getting out of school, or are simply looking for ways to improve yourself then this is a a great read for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2024
★★★★★ 5
Clear, practical and inspiring
Format: Kindle
12 Universal Skills is the perfect guide for building confidence at work. The authors focus on the skills that really matter and explain them in a way that’s easy to apply right away. It’s practical, motivating, and full of useful insights—ideal for anyone starting their career or wanting a fresh boost. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2025
★★★★★ 5
Essential Skills for Building Confidence at Work
Format: Kindle
Starting a new job or navigating a career change can feel overwhelming, but this guide makes the process much less intimidating. In 12 Universal Skills, Peter Scheele and Nina Bech-Andersen break down the habits and mindsets that lead to real success, focusing on practical skills like communication, resilience, and influence. The advice is clear and easy to apply, with examples that feel relevant, no matter your industry. What stands out is how the book encourages you to take small steps that add up to big results. By the end of the reading, you’re left with a toolkit that feels both empowering and realistic, a perfect package for anyone looking to build a strong base for their work life.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 22, 2025
★★★★★ 5
As a young professional just starting her career, this book is an excellent guide.
Format: Kindle
One of the things I appreciate most about this book is how it breaks down each skill into manageable and easy-to-understand sections. The author does an excellent job of explaining the skills clearly and concisely, providing real-world examples that help to bring each skill to life.
The 12 skills covered in the book are wide-ranging and cover essential areas such as teamwork, networking, communication, and decision-making. Whether you are just starting your career or looking to improve your skills as a seasoned professional, I found that this book has something to offer.
Another standout feature of this book is the practical tips and techniques. Overall, I highly recommend "12 Universal Skills: The Beginner's Guide to a Successful Work Life" for anyone looking to develop their professional skills. It is an excellent resource that can help you succeed in your career, and I believe that it will be particularly valuable to young professionals, like myself, just starting out.
So, if you are looking for a guide to help you develop the skills you need to succeed in your career, this book is an excellent place to start.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2023
★★★★★ 4
Soft skills
Format: Kindle
As a fresh graduate student from high school or even college and entering the workforce for the first time, soft skills such as communication, professionalism, team-building skills, and even how to handle conflict in the workplace, are sometimes hard to come by. This book will take you through 12 of the most essential skills you will need to be successful at work as well as your personal life. The two authors pooled their considerable work expertise and laid out the book in an easy to read and understand manner. I was able to really grasp what they were saying and what I needed to do in order to practice and develop my soft skills. A fantastic book for those starting out their careers!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2023