SKU: 30678838631

CXCL1 Protein, Human

Sale price$145.80 Regular price$162.00
Save 10%

Pay in installments of $40.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CXCL1 Protein, HumanProduct Specification Species Human Synonyms rHuGRO CXCL1, NAP 3, MGSA, Growth regulated alpha protein Accession P09341 Amino Acid Sequence Ala35 Asn107, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms rHuGRO-α/CXCL1, NAP-3, MGSA, Growth-regulated alpha protein
Accession P09341
Amino Acid Sequence

Ala35-Asn107, with C-terminal Human IgG Fc ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSNIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 35-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Pathol Res Pract . 2014 Feb;210(2):74-8. Epub 2013 Oct 28.

Background

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. In general, CXCL1 levels are extremely low under normal physiological conditions and significantly elevated under inflammatory conditions. CXCL1 acts as a key chemoattractant for neutrophils by binding specifically to its corresponding G-protein-coupled receptor CXCR2. CXCL1 regulates angiogenesis, tumorigenesis, and wound healing. In addition to increasing proliferation, CXCL1 also induces cancer cell migration, particularly EMT.Produced by lymphatic endothelial cells (LECs), CXCL1 enables tumor cell migration into the lymphatic vessels during lymphangiogenesis, leading to lymph node metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 30678838631

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Book Lover
Natrona Heights, US
★★★★★ 1
Uncomfortable
Color: Light Beige, Size: 38DD
In my search for a comfortable well-fitting bra, I came across this one. Reviews were good, so I ordered one. Half way through the day, I had to take it off. This is the most uncomfortable bra ever. This one went on to the "uncomfortable pile" pretty quick Not full coverage and not supportive. Side coverage is pretty good but straps are thin and do not lift.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
A
Verified Purchase
abby
Carnegie, US
★★★★★ 5
Best Bra for Top Heavy Girlies!
Color: Light Beige, Size: 40C
I tried HSIA in the past but non of the bras fit right but this bra is the best! I’m glad I gave HSIA another chance because this is the best bra I’ve ever had! I’m already top heavy and doesn’t add extra bulk. It’s comfortable and breathable. In top of all that it’s affordable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
A
Verified Purchase
Angel S.
San Leandro, US
★★★★★ 3
Much smaller cups
Color: Light Beige, Size: 36I
This has much smaller cups than indicated
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
S
Verified Purchase
Suzanne P.
Carnegie, US
★★★★★ 5
Professional and streamlined leather backpack
I’ve had a dozen or so backpacks to use for work (corporate environment), and I really love this one. The leather is of high quality, plenty of pockets, strong zippers, straps, and grab handle, and provides a polished, professional, well-put together look. In the rear, zippered compartment, I have a 15-inch HP laptop, an iPad, and a 1/2 inch notebook. The main compartment is spacious and holds chargers for each device plus a lot of other miscellaneous items. There are two front, zippered compartments (one is intentionally “hidden” behind the other) that offer a secure and accessible way to access smaller items like pens, air pods, keys, etc. Great purchase, and I would definitely buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2025
C
Verified Purchase
Chelsea Weiman
Massapequa, US
★★★★★ 5
Love it!!!
Color: Mocha Brown
I bought it because it's the perfect size for carry-on luggage on the plane, and it's big enough to carry several things. Excellent quality for the price. It looks super cute and goes with everything.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025

recommand products