SKU: 29033837416

Human IL-1beta, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-1beta, His tagProduct Specification Species Human Synonyms Catabolin Accession P01584 Amino Acid Sequence Protein sequence (P01584, Ala117 Ser269, with C 10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 19 kDa Observed MW: 20 kDa Purity 90% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Catabolin
Accession P01584
Amino Acid Sequence

Protein sequence (P01584, Ala117-Ser269, with C-10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19 kDa Observed MW: 20 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin-1 beta (IL-1β) is a proinflammatory cytokine that is mainly produced by monocytes and activated macrophages as a proprotein. Inflammatory responses are mediated by IL-1β in T cells, natural killer cells (NK cells) and B cells. It induces the production of pro-inflammatory cytokines (IL-2, IL-3, IL-6) as well as interferons. Furthermore, IL-1β modulates the secretion of cytokines by various subsets of human DCs.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29033837416

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MARY LISCOMBE
Lowell, US
★★★★★ 5
Paper towel holder
Color: Black, Material Type: Stainless Steel
Little flimsy not what it appears to look like but it gets the job done
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
D
Verified Purchase
Dandy
Houston, US
★★★★★ 3
Bottom screw will rust and permanently stain counter
Color: Black, Material Type: Stainless Steel, Color: Black, Material Type: Stainless Steel
Besides the ungalvanized or stainless steel bottom screw that rusts at the first sign of moisture this product has held up incredibly well. I've used the product for 3 years and that is the only problem. I'm probably going to get a deduction in my security deposit for the rust stains that have permeated the countertop. The rest of the product is really well made and holds up well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
D
Verified Purchase
Deborah V.
Belleville, US
★★★★★ 5
Crafting Convenience: Sturdy and Stylish One-Handed Towel Holder for Creative Spaces
Color: Black, Material Type: Stainless Steel
Thisit has become a great addition to my craft area. The struggle to find a convenient place for paper towels is real, especially when crafting can get a bit messy. Prior attempts with a magnetic holder fell short, as it couldn't support the weight of a full paper towel roll. The promise of a one-handed dispensing solution was intriguing and seemed like the perfect fit for my needs. While I can't unequivocally say this holder allows for flawless one-handed dispensing – it seems the success of that feature might depend on the angle at which the towel is torn – it's still a significant upgrade from my previous setup. The sturdy stand ensures the towels are always within reach, without the risk of the holder tipping over or the roll coming loose. Apart from its functionality, the aesthetic aspect of this towel holder is a notable advantage. Its minimalist design doesn't just save space; it also contributes to the overall look and feel of my crafting space. The wrought iron style is a perfect match with my other accessories, creating a cohesive and stylish environment. In conclusion, this towel holder is more than just a functional tool; it's a stylish addition that enhances the convenience and appearance of my crafting area. Its sturdy build, practical design, and complementary style make it a winner in my book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2024
D
Verified Purchase
DSaT
Grantham, US
★★★★★ 5
Nice quality and sleek paper towel holder!
Color: White, Material Type: Stainless Steel
Live the sleekness and quality of this paper towel holder. Blends in great with my white backsplash!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
J
Verified Purchase
Jennifer
Cuba, US
★★★★★ 5
Effective for under eye bags
Size: 1 Count (Pack of 6)
Workes for under eye bags fast. Very sticky and will definitely stay in place. For me I feel they are a bit too sticky so I reccomend putting on a moisturizer prior to use. The only gripe I had with them is that there is some product left behind after removal which pills when you go to apply a moisturizer or another product. Other than that they are great for the price. I would buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026

recommand products