SKU: 27699355593

Mouse CLEC7A, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CLEC7A, His tagProduct Specification Species Mouse Synonyms Beta glucan receptor, C type lectin superfamily member 12, Dendritic cell associated C type lectin 1(DC associated C type lectin 1; Dectin 1), Bgr, Clecsf12, Dectin1 Accession Q6QLQ4 Amino Acid Sequence Protein sequence (Q6QLQ4, Gly71 Leu244, with C 10*His)

Product Specification


Species Mouse
Synonyms Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1(DC-associated C-type lectin 1; Dectin-1), Bgr, Clecsf12, Dectin1
Accession Q6QLQ4
Amino Acid Sequence

Protein sequence (Q6QLQ4, Gly71-Leu244, with C-10*His) GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKELGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.5 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CLEC7A is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. It functions as a pattern-recognition receptor for a variety of β-1,3-linked and β-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Expression is found on myeloid dendritic cells, monocytes, macrophages and B cells. The C-type lectin receptors are class of signalling pattern recognition receptors which are involved in antifungal immunity, but also play important roles in immune responses to other pathogens such as bacteria, viruses and nematodes. Also operating as a co-stimulatory molecule via recognition of an endogenous ligand on T-cells, which leads to cellular activation and proliferation, CLEC7A can bind both CD4+ and CD8+ T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27699355593

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cristina
Cuba, US
★★★★★ 5
Easy to use and it actually works
So I live in Florida, taking care of your skin is super important. This is actually a great product, I actually use it to set my make up on the rare occasions that I wear any but on days that I don't This product is still great. It's not heavy or leaves a white cast like some of the other sun protection does. It doesn't leave my skin greasy but it helps to feel moisturized. Honestly I just spray it as I'm about to leave the house and I'm good to go. Plus it actually smells good, like very light tropical beach vibe. Best part it's never caused me to break out on my skin because I have very sensitive skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 23, 2023
K
Verified Purchase
Kimberly
Lake Worth, US
★★★★★ 5
Satisfied
Good quality. Product is exactly as described
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
J
Verified Purchase
Jordan Taylor
Massapequa, US
★★★★★ 5
Ulta Recommendation That Actually Delivered
Size: 1.7 Fl Oz (Pack of 1)
I was originally recommended this product by a representative at Ulta—and it completely changed the game! It’s super easy to apply, smells great in my opinion, and gives me a refreshing, lightweight feel without the heaviness of typical facial sunscreens.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2025
S
Verified Purchase
Sedum
Charlottesville, US
★★★★★ 5
Great scent and feel
Size: 1.7 Fl Oz (Pack of 1)
Not sure I understand the blue light feature of this, but I love how this feels during a hot day! I usually carry this when I go to the pool with the kids and use it to reapply after getting out of the water and watching them from the pool deck. I burn fairly easily and haven't burned using this, leading me to believe that it functions well. I like the smell and I like the cooling mist on hot summer days! One quibble, it does leak if not tightened carefully!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 17, 2025
O
Verified Purchase
One Click
Lexington, US
★★★★★ 5
Best mineral sunscreen
Size: 3.4 Fl Oz (Pack of 1)
Best sunblock. No white cast if you use the 30 spf. My dermatologist recommended this years ago and I’ve used it since.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026

recommand products