SKU: 47743940691

Human CD58, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD58, His tagProduct Specification Species Human Synonyms Surface glycoprotein LFA 3, LFA3 Accession P19256 Amino Acid Sequence Protein sequence (P19256, Phe29 Arg215, with C 10*His) FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 23. 1 kDa Observed MW: 33

Product Specification


Species Human
Synonyms Surface glycoprotein LFA-3, LFA3
Accession P19256
Amino Acid Sequence

Protein sequence (P19256, Phe29-Arg215, with C-10*His) FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 23.1 kDa Observed MW: 33-55 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD58, or lymphocyte function-associated antigen 3 (LFA-3), is a cell adhesion molecule expressed on APCs, particularly macrophages, and other tissue cells. CD58 binds to CD2 (LFA-2) on T cells and is important in strengthening the adhesion and recognition between the T cells and Professional Antigen Presenting Cells, facilitating signal transduction necessary for an immune response. Polymorphisms in the CD58 gene are associated with increased risk for multiple sclerosis. Genomic region containing the single-nucleotide polymorphism rs1335532, associated with high risk of multiple sclerosis, has enhancer properties and can significantly boost the CD58 promoter activity in lymphoblast cells. CD58 plays a role in the regulation of colorectal tumor-initiating cells (CT-ICs). Thus, cells that express CD58 have become a cell of interest in tumorigenesis. Mutations of CD58 have been linked to immune evasion observed in some lymphomas and studies are underway to analyze how its involvement directly affects classical Hodgkin lymphoma (cHL).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47743940691

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sage & Second Chances
Battle Creek, US
★★★★★ 5
The Toy Annie Always Comes Back To
Size: X-Small, Color: Pink
⭐⭐⭐⭐⭐ These have become one of Annie's all-time favorite toys. Annie is a tiny 4-pound dog, and she can be surprisingly picky about toys. She has a basket full of options, but she consistently comes back to her nubby Nylabones. I think the size and texture are a big part of why she likes them so much. They're easy for her to carry around, chew on, and play with by herself. Whenever I buy a new one, it quickly becomes part of her regular toy rotation. As a small-dog owner, I appreciate finding toys that are appropriately sized and actually get used instead of being ignored after a few days. If you have a tiny dog who loves to chew, these are definitely worth trying. They've been a favorite in our house for a long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
D
Verified Purchase
Diana Scharnus
Lowell, US
★★★★★ 4
Dogs love these!
Size: Small, Color: Pink
My miniature Goldendoodle puppies love these! The only drawback is after several weeks of chewing, the bones develop pretty sharp edges long before the actual bone has been worn down. At that point, they are dangerous for the dog’s gums and must be thrown away.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
P
Verified Purchase
princeton von d
Alexandria, US
★★★★★ 5
🦴 Micro Bone, Major Relief; Perfect Puppy Teething Chew Toy
Size: X-Small, Color: Blue, Size: X-Small, Color: Blue
🐾 Hi, I’m PVD; teething survivor, nub enthusiast, and gum massage advocate. This tiny blue bone was my day-one favorite from 8 weeks to 5.5 months, it handled every chew session, tantrum, and tooth eruption with dignity. I’ve officially “aged out,” but I still salute it. ⭐ Why it earned 5 stars: ✔️ Perfect XS size for toy breed jaws ✔️ Soft on sore gums, durable enough for dramatic chewing ✔️ Ridges + nubs = mouth spa treatment ✔️ Chilling it = elite teething relief ✔️ Kept me busy and prevented chewing on illegal things (furniture, shoes… mother) 🌀 Why I’m now gracefully retiring it (but still recommending): ✘ Jaw strength and confidence grew but I didn’t vibe with the larger size versions (tried and rejected them with judgment) ✘ Texture now too gentle for my post-teething chew style ✘ Advanced chewers may get bored once the rage-chewing era passes ✘ I get gum relief via Nylabone Nubz edible chews now Best For: • XS-Small breed puppies, especially under 5 lbs • Teething stages + gum relief • Delicate chewers or fur babies still in the love-bite phase • First-time puppy parents (trust me, this bone prevents household drama!) • 8 weeks–6 months old 🚫 Not for adult teeth or advanced chew techniques. 📝 Final Re-Barks: Iconic starter bone for toy breed pups. Affordable, safe, and genuinely soothing during teething chaos. It carried me through the hardest months (and saved several legs; both human and furniture). I’ve outgrown it; but I’ll forever endorse it for the next generation of tiny chewers. — PVD (Tiny Tooth Graduate, Former Chew Therapy Success Story 🧊🦴)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2025
U
Verified Purchase
UMmba
Whiting, US
★★★★★ 3
Nylabone Puppy Treat Starter Pack - A Mixed Bag of Delight and Disappointment
Size: Small, Color: Blue
I recently purchased the Nylabone Puppy Treat Starter Pack for my adorable 5lb puppy, and overall, I have mixed feelings about this product. While I was initially satisfied with the variety pack, one of the bones in particular left me disappointed due to its lack of durability. Let's start with the positives. The Nylabone Puppy Treat Starter Pack comes with three different toys: a blue puppy teething toy, a nylon dog toy, and a chew treat. This variety is great for keeping my puppy engaged and entertained, especially during the teething phase. The blue puppy teething toy is specifically designed for soothing sore gums, and my puppy seemed to find great relief when chewing on it. It has a pleasant texture that is gentle on the teeth and gums, making it an ideal choice for teething puppies. The nylon dog toy included in the pack is durable and sturdy. It has a satisfyingly textured surface that provides an excellent chewing experience for my little furry friend. The toy is designed to withstand the strong chewing habits of puppies, and it has certainly proven to be long-lasting compared to other toys I've tried in the past. My puppy enjoys gnawing on it for extended periods without any signs of damage. Now, let's address the bone that failed to meet expectations. One of the bones included in the pack was devoured by my puppy within a single evening. I was taken aback by how quickly it was consumed, especially considering my puppy's small size. While the other bones in the pack held up well, this particular one lacked the durability I had hoped for. I understand that puppies have strong jaws, but I expected the bone to withstand more than a few hours of chewing. Despite this disappointment, I must mention that the bone did not cause any harm to my puppy. It is important to supervise your puppy while they chew on any toys, especially if they have a tendency to swallow large chunks. In this case, I was fortunate that my puppy did not experience any adverse effects after consuming the bone. However, it's crucial to exercise caution and ensure that your puppy doesn't ingest anything that could potentially be harmful. Overall, while the Nylabone Puppy Treat Starter Pack has its upsides, I cannot ignore the fact that one of the bones failed to meet expectations in terms of durability. However, the other toys included in the pack provided a satisfactory experience for my puppy, and they have proven to be long-lasting. I would recommend this product with the caveat that you closely monitor your puppy's chewing habits and potentially avoid the bone that didn't hold up well in my particular case.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2023
R
Verified Purchase
Rafael A
Birmingham, US
★★★★★ 5
⭐⭐⭐⭐⭐ Great for teething puppies
Size: Small, Color: Pink
I purchased the Nylabone puppy chew toys for my teething puppy, and they’ve been a big help. The toys are the perfect size for a young puppy and feel durable without being too hard. My puppy enjoys chewing on them, and they’ve helped redirect chewing away from furniture and shoes. I also like that they’re designed specifically for puppies, so they’re gentle enough for growing teeth and gums. The variety in the set keeps my puppy interested, and the toys have held up well with daily use. They’re easy to clean and feel safe to give to a puppy. Overall, these are great chew toys for puppies. They’re effective, well made, and helpful during the teething stage. I would definitely recommend them to new puppy owners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025

recommand products