SKU: 24911785576

RENIN His Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RENIN His Tag Protein, HumanProduct Specification Species Human Antigen Renin Synonyms REN, FLJ10761, Renin, angiotensinogenase Accession P00797 Amino Acid Sequence Leu24 Arg406, with C terminal 8*His

Product Specification


Species Human
Antigen Renin
Synonyms REN, FLJ10761, Renin, angiotensinogenase
Accession P00797
Amino Acid Sequence

Leu24-Arg406, with C-terminal 8*His LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 45-53kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Yokosawa, H. et al. (1980) J. Biol. Chem. 255:3498. 2. Fuminaki, S. et al. (2004) in Handbook of Proteolytic Enzymes, Barret, A. J. et al. eds. p. 54.

Background

Human Renin is a member of the aspartyl proteinase family produced largely in part by the juxtaglomerular cells in the kidney. Renin is also known as REN and angiotensinogenase, is a circulating enzyme that participates in the body's renin-angiotensin system (RAS), and plays an essential role in the elevation of arterial blood pressure and increased sodium retention by the kidney. Renin activates the renin-angiotensin system by cleaving angiotensinogen, produced by the liver, to yield angiotensin I, which is further converted into angiotensin II by ACE, the angiotensin-converting enzyme primarily within the capillaries of the lungs. Renin is secreted from kidney cells, which are activated via signaling from the macula densa, which responds to the rate of fluid flow through the distal tubule, by decreases in renal perfusion pressure (through stretch receptors in the vascular wall), and by sympathetic nervous stimulation, mainly through beta-1 receptor activation. Renin can bind to ATP6AP2, which results in a fourfold increase in the conversion of angiotensinogen to angiotensin I over that shown by soluble renin. In addition, renin binding results in phosphorylation of serine and tyrosine residues of ATP6AP2. The level of renin mRNA appears to be modulated by the binding of HADHB, HuR and CP1 to a regulatory region in the 3' UTR. An over-active renin-angiotension system leads to vasoconstriction and retention of sodium and water. These effects lead to hypertension. Therefore, renin inhibitors can be used for the treatment of hypertension. Renin differs from the other members of this class by having a pH optimum near the neutral pH region with native substrates instead of a pH 2.0 to 3.4 range.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24911785576

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Boumarie
Massapequa, US
★★★★★ 5
Easy to chew
Size: 1.1 Pound (Pack of 1)
These treats were soft enough for my older dog who has lost several teeth. Also, he's a very picky eater but readily ate these. They're smaller pieces mostly, ranging from about 2 to 5 inches long, so they're perfect for smaller dogs. I'll definitely buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
C
Verified Purchase
couch potatoe
New York, US
★★★★★ 5
Great dog treats
Size: 1.1 Pound (Pack of 1)
Dog just loved these
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 4
Great treat but won’t last long
Size: 1.1 Pound (Pack of 1)
Great treat but not really a chew. It won’t last em long but they will love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
A
Verified Purchase
Angela Turney
Boise, US
★★★★★ 5
Great treat!
Size: 10.58 Ounce (Pack of 1)
Our medium 9 year old dog loves these. Fresh and easy to eat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
M
Verified Purchase
MaHurl
Omaha, US
★★★★★ 5
Soft, Healthy, & Budget-Friendly!
Size: 10.58 Ounce (Pack of 1)
I recently picked up some chicken jerky strips for my small dogs, and I couldn't be happier! My pups absolutely adore these treats, and it's such a relief to see them enjoy something they can actually chew. My senior Maltipoo, Jack, has had some dental issues, but these strips are just soft enough for him to munch on without any trouble. I love that they’re high in protein and grain-free, making them perfect for training without worrying about their digestion. Plus, the price is great! It feels good to find a treat that’s not only healthy but also budget-friendly. If you’re looking for something your small dogs will love, these chicken jerky strips are definitely worth a try!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2025

recommand products