SKU: 23007584350

ALK-1/ACVRL1 His Tag Protein, Human

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 His Tag Protein, HumanProduct Specification Species Human Synonyms HHT, HHT2, ORW2, SKR3, TSR I Accession P37023 Amino Acid Sequence Asp22 Gln118, with C terminal 8*His DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQGGGSHHHHHHHH Expression System HEK293 Molecular Weight 22 28kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms HHT, HHT2, ORW2, SKR3, TSR-I
Accession P37023
Amino Acid Sequence

Asp22-Gln118, with C-terminal 8*His

DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 22-28kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Cindy Lora Gil. Bruno Larrivée. Alk1haploinsufficiency causes glomerular dysfunction and microalbuminuria indiabetic mice. ScientificRepoRtS (2020) 10.


Background

The Bone Morphogenetic Protein (BMP) receptor activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23007584350

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dana
Pawtucket, US
★★★★★ 5
GREAT DURABILITY FOR MY XL SUPER CHEWER !
My dog LOVESSSSS this toy. It’s definitely one of her favorites! I have a Pit-Mastiff mix and she loves to chew toys, but her breed also means she’s got an outrageous amount of strength in those jaws, making it hard to find toys that can last without getting torn up super easily. We typically buy Kong “Super Chewer” toys and this has held up better than those! We’ve had it a good few months and it’s super durable. She gnaws on this thing every day for a good bit of time, and it doesn’t have any weak spots, holes, chunks missing, NOTHING, except a few dimples. It’s firm but also has give to it that (I think) really provides a good chewing option. It’s got enough weight and give to it that I can throw it for her and it’ll bounce without flying around crazy like some toys. The toy itself is not super cute, but my dog definitely is when she’s carrying it around everywhere 🥹 My only con is that I wish it came in other colors! I was surprised that she liked it so much because she typically prefers bright colored toys like red/orange/blue/green. It took some time, but once she warmed up to it and realized she could chew as hard as she wanted on it, it was game over from there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2025
M
Verified Purchase
Marty
Belleville, US
★★★★★ 4
Durable dog toy
Solid toy for Malinois
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
D
Verified Purchase
Debi Mason
Chelsea, US
★★★★★ 5
Extremely Durable
This is truely for heavy chewers. Both my bully mixes have chewed through every bone/ball including Kong. They have had these for about 6 months and they are hardly worn. The dogs love chewing on them too. I wish they came in flavors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
C
Verified Purchase
Cherrieleneay
Cuba, US
★★★★★ 5
Must have toy
Found out the hard way my sweet little shy rescue pup can chew through any toy in under 5 min. If it says indescribable they have never met her....until this toy. It has been almost two weeks now. She loves this thing and you cannot tell she has even tried to destroy it. If she does manage to somehow I am instantly buying another. This thing is awesome, a must have for super cheers, and she LOVES it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
K
Verified Purchase
KA
San Leandro, US
★★★★★ 1
Not even close to "virtually indestructible" as described.
Within an hour of receiving this K9 Chew Stick, our 55lb Staffordshire Terrier began chewing pieces off the top of toy. Initially, we were happy to see that our dog enjoyed the chew toy, and it appeared to be durable. For the high cost of this toy, it is very disappointing that pieces can start coming off that quickly. Luckily, our dog wasn't swallowing the pieces, which can easily lodge in their intestines. If your dog is NOT an aggressive/determined chewer or they are happy with chewing for very short periods of time, this toy might be okay for them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products