SKU: 22238380873

Human TPX2, His tag

Sale price$45.00 Regular price$50.00
Save 10%

Pay in installments of $12.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 21 - Sep 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TPX2, His tagProduct Specification Species Human Synonyms Differentially expressed in cancerous and non cancerous lung cells 2 (DIL 2), Hepatocellular carcinoma associated antigen 519, Hepatocellular carcinoma associated antigen 90, Protein fls353, Restricted expression proliferation associated protein 100 (p100), C20orf1, C20orf2, DIL2, HCA519 Accession Q9ULW0 Amino Acid Sequence Protein sequence (Q9ULW0, Gln213 Asp349, with C 10*His)

Product Specification


Species Human
Synonyms Differentially expressed in cancerous and non-cancerous lung cells 2 (DIL-2), Hepatocellular carcinoma-associated antigen 519, Hepatocellular carcinoma-associated antigen 90, Protein fls353, Restricted expression proliferation-associated protein 100 (p100), C20orf1, C20orf2, DIL2, HCA519
Accession Q9ULW0
Amino Acid Sequence

Protein sequence (Q9ULW0, Gln213-Asp349, with C-10*His) QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 17.9 kDa Observed MW: 18 kDa
Purity >90% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Targeting protein for Xklp2 is a protein that in humans is encoded by the TPX2 gene. It is one of the many spindle assembly factors that play a key role in inducing microtubule assembly and growth during M phase. Because of its integral role in microtubule assembly and therefore mitosis, TPX2 is found to be overexpressed in different types of human cancers including hepatocellular carcinoma (HCC), medullary thyroid cancer, bladder carcinoma, and estrogen receptor-positive metastatic breast cancer and contributes to tumor growth and metastasis. As a result, TPX2 has recently been a topic of interest for learning more about the relationship between mitotic errors and tumorigenesis, along with novel cancer therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22238380873

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
bclmb
Charlottesville, US
★★★★★ 4
Nice design, pay attention to the size specification
Size: Small (Pack of 1), Style: Monkey
Nice toy with minimal appendages - meaning that body parts are not quickly chewed off. I made the mistake of getting this one along with one for the Large dog. This monkey is intended to be a small dog toy and as soon as I felt it, I knew my English Shepherd of 8 months would probably have it torn up within a day or two. I really like the design - no ropes or braids or legs, no small pieces for the eyes, etc. The monkey does have a small curly-Q tail but so far it's stayed attached to the monkey. It's durability has surprised me so far. For years I have had a Jack Russell terrier, which I think might be considered a small/medium dog (at least mine was). This toy would have lasted him weeks or even months, he didn't set out to eat his toys. Now I have an English Shepherd and I forget that she's probably considered a large dog. She rarely chews up anything EXCEPT her toys, but when she gets a new toy, she spends hours "getting to know it" and she's got pretty sharp teeth. The fabric on this toy is durable, not easily torn. Because there is no stuffing the squeaker is easy for the dog to squeak - and if your dog hasn't had squeaky toys before, that might freak them out just a little, it did my dog, she started off apprehensive of the toy but quickly grew to enjoy it. Because this toy is hollow and not dense, my dog doesn't chew on it the same way as she did her rope-style toy, and therefore this toy has lasted longer than the KONG Pudge Braidz Pig Dog Toy, Medium/Large toy (which lasted about 10 minutes). Someone else here posted some good pictures of their larger sized dog with this toy, and that dog looks to be about the same size as mine. That person stated the toy didn't last long and showed pictures of how it looked after being dismantled. I expect that to happen to this one since that dog's size is similar to mine, although it's lasted so far more than a day. I guess it partially depends on not just the toy but the dog, too. Because there's no density to this toy, my dog doesn't seem to want to chew it like she does a bone, instead she tosses and wrestles it, occasionally making it squeak, then lies down next to it and takes a nap. All in all, this is so far, my favorite dog toy brand. It's less dangerous than the Kong toys or the Nylabone toys, and especially less dangerous than the rope style toys. I purchased several other Petstages toys and so far, they have lasted longer than any other brand, including those named. I just should have been more attentive to the recommended dog size, as this toy is clearly not ideal for large dogs. The Petstages Gator toy is better for a large dog. I have also purchased that one and find it much more suitable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2015
R
Verified Purchase
Ron Balentine
Lake Worth, US
★★★★★ 3
Could be made much stronger & better
Size: Small (Pack of 1), Style: Monkey
Only 3 stars because the long fur is nasty and dogs chew it and it comes off … choking hazard. I trim it when I get them. The fabric is to easily tear doednt last long they should make this much stronger. I’ve bought 4 of these and about to buy 2 more my dogs love them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
M
Verified Purchase
MSomwhat
Houston, US
★★★★★ 5
So cute! Durable!
Size: 1 Count (Pack of 1), Style: Shark
These are my dogs “babies” and we are on #3! Adorable! She loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
Aubrey
Louisville, US
★★★★★ 5
great dog toy for small and large!
Size: Medium (Pack of 1), Style: Gator
we have a very large silver lab that tears through toys, and very fast! some toys only last a day while others last a week or so... he has yet to tear this on up at all and we have had it for about 3 weeks. we also have a very small teacup yorkie, so some toys we get he cannot even play with, this one he can squeak and carry around which is great! it very quickly became one of their favorite toys! will buy again if he ever does destroy it !!! update: after a month of the lab and small yorkie playing with this some of the fabric stared to tear on the end of the toy, they still love it and it still squeaks perfectly fine. didn't think it would last this long with the big lab, will order new one when they do finally destroy it for good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2015
L
Verified Purchase
LiLi Conway
Lowell, US
★★★★★ 4
A must have for my little puppers
Size: Small (Pack of 1), Style: Monkey
Bought this for a Chihuahua. He came from a bad situation that gave him screaming dreams of terror in the middle of the night, waking up, screaming. I would find him frozen in absolute terror. Poor dude. Now, he seems full of rage, and I get it because I know half of his story. And we love him anyway. He has 2 big brothers that will help show him the way, living his best life ever! Long story short; I first started buying this Petstages toy many years ago for my blind MinPin. Seeing it still, out here for sale always puts a smile on my face. Back then, they were a better quality. Now-a-days, the material around the squeaky is on the loose side, making it easier to destroy when my big dogs get it. Still, it brings back wonderful memories, is soft for a small dog that doesn’t destroy his things, it squeaks and they are usually loud (which is a must have, if you ask me), and it is cute to boot!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2025

recommand products