SKU: 90749489529

Human TPX2, His tag

Sale price$45.00 Regular price$50.00
Save 10%

Pay in installments of $12.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 21 - Sep 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TPX2, His tagProduct Specification Species Human Synonyms Differentially expressed in cancerous and non cancerous lung cells 2 (DIL 2), Hepatocellular carcinoma associated antigen 519, Hepatocellular carcinoma associated antigen 90, Protein fls353, Restricted expression proliferation associated protein 100 (p100), C20orf1, C20orf2, DIL2, HCA519 Accession Q9ULW0 Amino Acid Sequence Protein sequence (Q9ULW0, Gln213 Asp349, with C 10*His)

Product Specification


Species Human
Synonyms Differentially expressed in cancerous and non-cancerous lung cells 2 (DIL-2), Hepatocellular carcinoma-associated antigen 519, Hepatocellular carcinoma-associated antigen 90, Protein fls353, Restricted expression proliferation-associated protein 100 (p100), C20orf1, C20orf2, DIL2, HCA519
Accession Q9ULW0
Amino Acid Sequence

Protein sequence (Q9ULW0, Gln213-Asp349, with C-10*His) QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 17.9 kDa Observed MW: 18 kDa
Purity >90% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Targeting protein for Xklp2 is a protein that in humans is encoded by the TPX2 gene. It is one of the many spindle assembly factors that play a key role in inducing microtubule assembly and growth during M phase. Because of its integral role in microtubule assembly and therefore mitosis, TPX2 is found to be overexpressed in different types of human cancers including hepatocellular carcinoma (HCC), medullary thyroid cancer, bladder carcinoma, and estrogen receptor-positive metastatic breast cancer and contributes to tumor growth and metastasis. As a result, TPX2 has recently been a topic of interest for learning more about the relationship between mitotic errors and tumorigenesis, along with novel cancer therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90749489529

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Ken
Lexington, US
★★★★★ 5
XS great fit very pleased!! 5’8”-5’9” 140 lbs
Color: Dark Grey, Size: X-Small
My son is wearing this to prom he is about 5’8”-5’9” all muscle 140 lbs and I had to order an xs in grey. The small jacket was good but the pants were to big/baggy. The quality is nice and wow the fit is great!!! So pleased. I will try to update later with a picture
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
J
Verified Purchase
Joe
Charlottesville, US
★★★★★ 5
Just an unbelievable purchase and strongly recommend
Color: Black, Size: Medium
Unbelievable! One of the BEST purchases I made. Fits perfectly, wasn’t wrinkled at all. In fact, I don’t need to take it to the cleaners to be pressed. Class all the way. Well made, elegant, fabric was perfect as it was not too thin. Compared to tuxedos in the store and this was exactly the same. Only difference is this suit was $150 less!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
T
Verified Purchase
Tiffany Davis
Lowell, US
★★★★★ 4
Good. Decent quality.
Color: Black, Size: Small
The quality is good, especially for the price. I didn’t like that the wrist buttons were non functional. We bought cuffs that he couldn’t use. It looks nice. The size is a little big for my son, but that was kind of expected. I was hoping we would get lucky and that wouldn’t be the case but I couldn’t find any suites in a smaller size that would arrive on time. He is 5’7, 120-125 pounds. It was mostly in the shoulders that it looks big. He is thin. The arm length fit him but he does have long arms. The pants fit with a little looseness. His jeans size at American eagle is 28/36, but he can fit slightly bigger with a belt. The pants were good but the vest and jacket were a little big. They’re just slightly long and jacket is big in the shoulders. We got a size small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
S
Verified Purchase
Santino Gaeft
Charlottesville, US
★★★★★ 5
QUALITY AND COMPORTABLE FITTING IN LOWER PRICE...
Color: Navy, Size: Large
WOW! this suit really true to its sizes description... I ordered in a different company before this, but I have to return it TWICE because of wrong size fittings... Finally, this beautifully tailored suit timely arrived before my son's wedding reception, and we are ready to celebrate!!! Thank you and might order some different colors in the future... I wonder if they can make the pants in higher waist and straight cut or wider for the legs in the future as an option... Just a thought since slim fit pants are slowly outdating...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
B
Verified Purchase
Bartbc
Pawtucket, US
★★★★★ 5
Great quality product!
Color: Black, Size: Large
Great product and great fit. I ordered a Large and normally wear a 42 Regular. Jacket was perfect, as was the vest. Pants waist is flexible and fit fine but length needs to be shortened. Overall, I’m impressed with this product! Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products