SKU: 199256381

Human CD81, His Tag

Sale price$119.25 Regular price$132.50
Save 10%

Pay in installments of $33.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD81, His TagProduct Specification Species Human Synonyms 26 kDa cell surface protein TAPA 1, Target of the antiproliferative antibody 1, Tetraspanin 28 (Tspan 28) Accession P60033 Amino Acid Sequence Protein sequence(P60033, Phe113 Lys201, with C 10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 4kDa Actual: 11kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28)
Accession P60033
Amino Acid Sequence

Protein sequence(P60033, Phe113-Lys201, with C-10*His)


FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.4kDa Actual:11kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70℃ as supplied.

1 month, 2 to 8℃ under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

CD81 is a member of the transmembrane 4 superfamily and it is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Moreover, CD81 plays a critical role in Hepatitis C attachment and cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. The large extracellular loop of CD81 binds the hepatitis E2 glycoprotein dimer. It also appears to play a role in liver invasion by Plasmodium species.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 199256381

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MARIA SEGURA SOTO
Whiting, US
★★★★★ 5
Lo recomiendo
Flavor Name: Bacon - Kit
Muy útil, para la limpieza dental de mi perrita. Y el sabor del producto le encantó.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
O
Verified Purchase
ocasio
Charlottesville, US
★★★★★ 5
My favorite toothbrush for my fur babies!
Color: Pink (2-pack)
I think these brushes are the easiest way to brush your fur babies teeth. I can get into their mouths and really see in there and brush each tooth and make sure the tarter is off. They even assist by trying to bite the brush and I use toothpaste for dog and gently brush back and forth first the front teeth then the side teeth then the inside teeth and the top of the teeth then the inside of the bottom and top teeth and I end with the left inside top and bottom teeth. I use vanilla mint toothpaste for dogs because my dogs are allergic to proteins. Their teeth look so white and their vet comments that their teeth look so great and clean. She does want them of course to have their yearly cleaning but she said there is no rush because their teeth are so clean and she sees no dental disease. I make sure that I wash the brushes daily with soap and keep them open after use otherwise mold will grow on them if you shut them in the case they come in. My pups weigh 6 lbs and 7 lbs and are Maltese females. They cooperate fully with me brushing their teeth because I started when they were puppies and now they are one and two years old. These brushes are lightweight and not expensive at all. I usually buy several at a time to make sure I have clean ones on hand just like you would change a human toothbrush monthly. Each pup gets its own toothbrush and I label the case for each with a marker. I like these better than a regular toothbrush because it’s 360 degrees and the pup can chew on it without hurting themselves or the bristles coming off. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
A
Verified Purchase
akjruthies
Birmingham, US
★★★★★ 5
Dog Approved - Highly Preferred Over Standard Toothbrush
Color: Neon (4-pack)
These pet finger tooth brushes work well for me and my dog. He most definitely tolerates these so much more than a standard tooth brush. I believe I am able to reach more of his teeth and that I'm more effective brushing with these than I am with a standard brush. I put one on each of my index fingers. This makes it easier to do each side and the top and bottom without having to twist and turn to reach everything. The size is just right for my index fingers. They are a little tight getting them on and I have found that wetting my finger and the inside of the finger brush makes it a lot easier to put them on. The bristles on the finger brushes are soft, yet they are durable enough to give some good scrub quality and gum massage. These are a good price for what you get. I purchased the four-pack at right about $16.00. I have gotten numerous uses so far out of the two that I have been using. I will definitely purchase these again when it is time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2025
P
Verified Purchase
Patrice Dickinson
Cuba, US
★★★★★ 4
Probably Best for Medium-Large Size Dogs
Color: Blue (2-pack)
This finger cot–style toothbrush works well and is a simple way to brush your dog’s teeth, especially if they’re not comfortable with a traditional toothbrush. The material is soft yet effective at cleaning, and it gives you good control while brushing. The only drawback is that it’s a little large for my miniature Dachshund’s mouth, making it somewhat difficult to reach all areas comfortably. It would probably be a better fit for medium or larger dogs. Even so, it gets the job done and is a good option for introducing dogs to regular dental care.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
L
Verified Purchase
Lemons Limes
Lake Worth, US
★★★★★ 5
The easiest and best tooth brush!
Color: Pink (2-pack)
Ive tried several other dog tooth brushes for my 74 lbs Coonhound. This style and brand is the only one that is easy and works for us. It's easy to move your finger around and all sides of it have the cleaning nodules so no matter which way your finger turns, they are always touching her teeth. I like to try to open her mouth and get the inside of the mouth too. I loop my finger around her fangs. It is soft without harder parts so it doesn't make her pull away. This brush is perfect. It's a good quality and comes with a container for storage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026

recommand products