SKU: 1810816117

Human E-selectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human E-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM 1), Leukocyte endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1 Accession P16581 Amino Acid Sequence Protein sequence (P16581, Trp22 Pro556, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM-1), Leukocyte-endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1
Accession P16581
Amino Acid Sequence

Protein sequence (P16581, Trp22-Pro556, with C-10*His) WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 60.3 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

E-selectin is a selectin cell adhesion molecule expressed only on endothelial cells activated by cytokines. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. E-selectin binding to colon cancer cells correlates with increasing metastatic potential. Cancer cells of multiple tumor types bind E-selectin using glycoprotein or glycolipid ligands normally expressed on immune cells that eventually results in a tight binding between tumor cells and the activated endothelium. In addition, E-selectin may also function to recruit monocytes to primary tumors or lung metastases to promote an inflammatory pro-tumor microenvironment. E-selectin is an emerging biomarker for the metastatic potential of some cancers including colorectal cancer and recurrences. In cases of elevated blood glucose levels, such as in sepsis, E-selectin expression is higher than normal, resulting in greater microvascular permeability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1810816117

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon customer
Cuba, US
★★★★★ 4
Finally, a Calm That Feela Natural
Size: 90 Count (Pack of 1)
I've tried a lot of "calm" supplements over the years, and Nature's Way Calm Aid is one of the few I've actuallt reordered. I started taking it during a stressful stretch at work when my mind wouldn't slow down at night. Very shortly after taking it I felt more settled and less on edge. it takes the edge off without making me feel like I'm dragging through the day. The softgels are small and easy to swallow with no weird aftertaste. This has been a real game changer for me. If you're looking for something subtle but effective to help you stay calm and focused, CalAid is definitely worth trying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
B
Verified Purchase
Beverly
Port Orchard, US
★★★★★ 5
Great Addition to My Daily Routine
Size: 16 Ounce (Pack of 1)
Excellent Quality MCT Oil — Great Addition to My Daily Routine I purchased this MCT Oil and have been very pleased with it. It is light, smooth, and easy to add to my daily routine without changing the taste of my food or drinks. I especially like that it mixes well in coffee, tea, smoothies, and even oatmeal. It does not have a strong flavor or unpleasant aftertaste, which makes it very convenient to use every day. Overall, I would definitely recommend this MCT Oil to anyone looking for an easy way to add healthy fats to their diet. It is high quality, easy to use, and a great value for the price. I would purchase it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
K
Verified Purchase
KG
Charlottesville, US
★★★★★ 5
Great product!
Size: 16 Ounce (Pack of 1)
This stuff is amazing! It is odorless, flavorless and does its job with helping boost energy and helping you feel full. I put it in my morning coffee and it gives me just the boost I need. I HIGHLY recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
M
Verified Purchase
Mongoose
Los Angeles, US
★★★★★ 5
Great for carnivore.
Size: 30 Fl Oz (Pack of 1)
Great quality oil for Carnivore / Keto! A few precautions: - Start slow; too much too soon will cause gastric issues. 1/2tsp for the first few days, then increase to 1tsp for a few days and so on until you work up to a level you can tolerate. Get a shot glass with measurement lines. - Stay hydrated. MCT is a diuretic and may cause headaches if you are not hydrated. Consider taking some electrolytes with it and plenty of water. - If you find it gives you jitters; consider taking it with food. It can cause a little bit of a "high" if your not used to the immediate energy / mental clarity boost; which may freak some people out. Taking it with food will slow down the onset so it's not hitting you like a ton of bricks. - I personally don't mind the texture but it definitely goes down easier if it's cold; ymmv. No taste, but it's going to make your mouth feel oily for a minute.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
C
Verified Purchase
Castiel
Alexandria, US
★★★★★ 4
Good quality oil, but the dispenser is a nightmare to use
Size: 16 Ounce (Pack of 1)
This MCT oil is truly odorless, colorless, and tasteless. While the oil quality itself seems good, the dispenser on the cap is terrible. I understand the design is meant to keep air out, but you have to squeeze the bottle quite hard to get any oil out, making it impossible to control the flow. Every time I try to pour a small amount onto a spoon, it shoots out and splatters all over my hands and the counter. Now, I just take the entire cap off, pour it onto the spoon, and close it back up. Great oil, but the bottle design needs a major update.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products