SKU: 53699894690

Human Doublecortin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX
Accession O43602
Amino Acid Sequence

Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 11.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53699894690

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Carl L. Bradley
Battle Creek, US
★★★★★ 1
Kinda flimsy…
Thought the assembly was metal, it’s some kind of PVC.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 22, 2025
M
Verified Purchase
Melvin Marsh
Cuba, US
★★★★★ 5
100% worth the money
Size: 16'' x 43'', Size: 16'' x 43''
Great product. They look good and function well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 5
Cheaper than the supply house.
Size: 42'' x 28''
I used black pipe similar to this to build some shelves in my man cave. I went looking to build a studio desk and found that Lowe's wanted $8 per floor flange (~$96 just for flanges and not including the pipe, tees, or the other fittings). Even supply house dot com wanted $4 per flange (~$48, but was still missing the other parts AND they didn't offer them because of supply chain issues). For about $65, this was a great buy. Yes everything is greasy. This will be the case regardless of where you buy it. I used some gloves, shop towels, and acetone and it cleaned up easily. For a top, I used a pre-made countertop from Lowe's (~$100) and a 1x4 piece of poplar I had sitting around.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2023
M
Verified Purchase
mjh
Lowell, US
★★★★★ 4
Pipes don't assemble square, nice stand though.
Size: 42'' x 28''
These arent standard SCH40 pipe for starters. Significantly lighter. Easier to move around and sturdy enough to support a table, but this isnt pipe. As such, when I threaded it together, it wasn't square. I was able to flatten it mostly, but I had to use a clamp to bend the assembled piping to sguare so it would attach to the table runners. It's fine, but it surprised me. It looks nice, and it provides plenty of support for the table. All good. Several folks complained that the pipes are oily. They are supposed to be to prevent rust. I wiped them down with a few cleaner wipes, and they are fine. Be aware that this doesn't come with instructions or the wood screws you may need for your table top.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2023
D
Verified Purchase
Dj rad dad
Grantham, US
★★★★★ 5
Sturdy & Tuff going on 6 months +
Size: 28'' x 14'', Size: 28'' x 14''
I mounted a thick heavy piece of butcher block to these legs and made a desk. Easy to assemble and install. Mark the holes, pre drill pilot holes and screw them in. I will say I knew they were going to be greasy out of the box. They grease them in the factory to prevent rusting so just wipe them off with an old rag and your good to go. They haven’t felt wobbly or anything like that and butcher block is pretty heavy. I have to say I love them and much cheaper than buying from the hardware store. I’m thinking about building a second one and I would definitely purchase again. Again very sturdy and easy to assemble. People mad about the grease need to realize it’s done as an anti rust measure and it wipes right off and zero rust thus far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2023

recommand products