Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 25 - Aug 30
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA6/CD85b/ILT8 His Tag Protein, HumanProduct Specification Species Human Accession Q6PI73 1 Amino Acid Sequence Gly24 Asn447, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | Q6PI73-1 |
| Amino Acid Sequence | Gly24-Asn447, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-7 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
LILRA6, Leukocyte Immunoglobulin-like Receptor subfamily A, member 6, also called CD85b and ILT8.The leukocyte immunoglobulin-like receptor (LILR) multigene family is a family of paired receptors composed of inhibitory and activating forms, which are highly homologous in their extracellular regions and different in their intracellular regions. LILRA6 is the activating forms, which have two or four Ig-like domains with short cytoplasmic tail and associate with FcRγ chain containing immunoreceptor tyrosine-based activation motifs. LILRA6 (ILT8/CD85b) and LILRB3 (ILT5/CD85a) are paired receptors expressed by myelomonocytic leukocytes. LILRA6 and LILRB3 have high similarity in their extracellular domain, making them further difficult to distinguish., and mAbs generated against these receptors bind to neutrophils. In addition, LILRA6 is correlated with susceptibility to atopic dermatitis. LILRA6 on the surface of macrophages induces and regulates cytokines such as IL-4, IL-10, IL-17, TNFα and IFN-γ.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.7 ★★★★★
Based on 22 reviews
Sort
Product Reviews
★★★★★ 4
Solid Purchase
Size: X-Small, Color: Red
This coat delivers strong quality and clean style. The fabric feels sturdy and warm, and it holds its shape well in cold weather. The color stays bright, and the stitching looks secure. The fit is true to size, and the coat layers easily over sweaters without feeling bulky.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2025
★★★★★ 5
Coat lover
Size: Large, Color: Black
This coat is warm, stylish, and very well made. The stitching is clean and the fabric feels durable. It’s perfect for layering and works great with jeans or leggings. I love that it keeps me warm without feeling bulky. Great value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
★★★★★ 5
Good quality
Size: Medium, Color: Navy
I gave this as a Christmas present and he loved it. I was worried when I ordered it that the quality might not be that good, but I worried for nothing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
★★★★★ 3
This is more like a long cardigan sweater, than a coat.
Size: Small, Color: #2 Blackandwhite
This is more like a long cardigan sweater, than a coat. It doesn't have much structure & the pocket placement is too high for a coat. That being said, it's very soft & comfortable. As far as sizing goes, the sleeves run a bit long, but the coat, itself, runs a bit tight. I'm 5'10'' and a small fit me, but I wouldn't be able wear anything very thick under it & I'm thin. It's light & machine washable. I almost kept it to wear as a long sweater, but it looks like a coat ,so I sent it back. If you're very thin with long arms and don't mind the pockets being a bit high, then this could be a very stylish piece for you. Otherwise, I would pass.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
★★★★★ 5
i would definitely recommend. stick with your regular size or size up for a less slim fit
Size: Small, Color: Black
I usually wear a medium, I ordered a small based on reading the reviews. I am 150lbs 5’4”. this coat fits great for me personally. it’s not bulky, it’s not baggy. it is a slim fit jacket, definitely more on the slender side. when i raise my arms above my head , the sleeves do come up a bit. I would suggest sticking to your normal size or if you want a less slim fit with a tiny bit more room, sizing up wouldn’t be an issue. the coat is super soft and has some weight to it. i would recommend this jacket, it is warm and a nice piece for formal attire.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
recommand products
LA 1121 - Church Road, Bispham, Blackpool, Lancashire
13.00
LA 1101 - Grosvenor Street, Radcliffe, Manchester, Lancashire c1905
13.00
Women's Loose Batwing Sleeve Color Block T-Shirt
29.99
🔥Early Christmas Sale🍭Candy Cane Christmas Wreath🍭
32.99
LA 1027 - Manor Farm Dairy, Old Trafford, Manchester, Lancashire c1910
10.95