SKU: 90108228903

Biotinylated TNFSF11/RANKL Avi&Fc Protein, Human

Sale price$688.50 Regular price$765.00
Save 10%

Pay in installments of $191.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated TNFSF11/RANKL Avi&Fc Protein, HumanProduct Specification Species Human Synonyms RANKL, CD254, TRANCE, OPGL, ODF Accession AAC51762. 1 Amino Acid Sequence Gly 64 Asp245, with N terminal Avi Tag & Human IgG1 Fc

Product Specification


Species Human
Synonyms RANKL, CD254, TRANCE, OPGL, ODF
Accession AAC51762.1
Amino Acid Sequence

Gly 64-Asp245, with N-terminal Avi Tag & Human IgG1 Fc GLNDIFEAQKIEWHEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGSGGGSGGGSGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Paul R. Odgren, Nacksung Kim, Carole A. MacKay, April Mason-Savas, Yongwon Choi &Sandy C. Marks, Jr.: The Role of RANKL (TRANCE/TNFSF11), a Tumor Necrosis Factor Family Member, in Skeletal Development: Connective Tissue Research, Volume 44, 2003, Pages 264-271.

Background

RANKL (also known as TRANCE or OPGL) is a member of the TNF ligand superfamily. RANKL is produced by T cells, mammary epithelial cells and endothelial cells. RANKL, through its ability to stimulate osteoclast formation and activity, is a critical mediator of bone resorption and overall bone density. RANK and RANKL are key regulators of bone remodeling and regulate T cell/dendritic cell communications, and lymph node formation.RANK-RANKL signaling not only activates a variety of downstream signaling pathways required for osteoclast development, but crosstalk with other signaling pathways also fine-tunes bone homeostasis both in normal physiology and disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90108228903

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sir Keith
Cuba, US
★★★★★ 5
This is the one you want...
Size: 2' x 6' (Natural), Color: Natural (Yellow Undertones), Size: 2' x 6' (Natural), Color: Natural (Yellow Undertones)
I bought a ‘Genuine Sheepskin Rug Double Pelt Natural White Fur 2x6’ from Amazon in 2011 for $112.49, and recently decided to recommission it in my new living room. It looked so nice that I decided to add a second rug, and was pleased to find what Amazon claimed to be the same rug still available for only $83.78. Now I’m not one of those silly folks who expects the color and/or size of a natural product like a sheepskin rug to be perfectly predictable, and my living room is large enough that I didn’t need the two rugs to match perfectly, but when the new rug arrived, I couldn’t have been more disappointed. It was about 40% smaller than my older rug, was way, way off from anything that could be called white, and looked cheap, old, and tattered. I tried to comb it out a bit to see if I could make it look presentable, but it was a lost cause. Amazon to the rescue. I returned the rug to Amazon for a full refund the next morning, and the transaction couldn’t have been simpler. And I immediately ordered the ‘Genuine Sheepskin Rug Double Pelt Natural White Fur 2x6’ shown on this page from Super Area Rugs for $119.00. What a difference! These rugs are large, plush, and super soft. The quality of these rugs is obvious, much, much nicer that either my old sheepskin rug or the ‘bargain’ rug I returned to Amazon. I was so impressed with the quality of this rug that I immediately ordered a second, which arrived this morning (it matches the other rug perfectly). My older sheepskin has been reassigned to another room because, well, it’s not in the same league as my two new rugs, which look terrific together. As is so often the case, you get what you pay for. So if you’re looking for a top quality sheepskin rug, this is the one you want.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2015
J
Verified Purchase
Jay K
San Leandro, US
★★★★★ 4
Very nice fleeces
This is a clean, soft, well groomed fleece intended for use on a 6 foot long sofa, so bought 2. They moved too much as a result of shifting bodies on the leather couch, so will get a longer version, sewn bottom to bottom, and used each of these fleeces on both armrests, instead.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2025
S
Verified Purchase
Shawn B.
Charlottesville, US
★★★★★ 5
Excellent Product!!! Will purchase again!
Size: 2' x 3' (Natural), Color: Wolf Tipped
Instead of ordering a cover for reclining loveseats, I chose to drape one of these over the headrest on either end of our loveseat. Not only do they protect the leather, they also help to elevate our decor. The rugs were received in a very timely manner. They are super soft, & warming as we move into the winter months. We've had family & friends comment on how great they look. 2 of them have already ordered, & added them to their sofa/loveseat/recliner decor. Have an issue of them slipping, add some velcro in between the crook of the cushion & the back of the furniture piece. It doesn't show & will help to keep the rug in place; if your busy body.!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
C
Verified Purchase
ChillyNilly
San Leandro, US
★★★★★ 5
Perfect for sensory sensitive kids and for the pure beauty of it
Size: 2' x 6' (Natural), Color: Natural (Yellow Undertones), Size: 2' x 6' (Natural), Color: Natural (Yellow Undertones)
After speaking over the phone with the seller, I was confident in this purchase for my SPD son. They do not use harsh chemicals or dyes in the process. It is from New Zealand and the only use in Vietnam is for shipping. My son hasn't been diagnosed yet for Autism but he is in the process. He is super sensitive to all things sensory and Amazon feedback isn't the place to give specific details on his condition but I will write that when he fist touched it- which was willingly- he smiled and asked to sleep on it. When he laid down on it and I covered him- he was calm and smiling. In the pic I provided he is calm and holding his door (his obsession is doors and windows). He even set his door down to hold the fur. For other mommies and papas with spd/autistic kids you know that willingly touching a new fabric and setting down an obsessive item is huge and super encouraging! I am so grateful to have such a quality item that is affordable for my special needs son. His older sister received one as well as is now pretending to be a sheep. Fun for everyone! The ONLY negative is that the brand/info sticker on the pelt was a pain to get off and pulled some of the felt - not damaging it but blemishing the unity -but if the skin is down it will not be noticeable. A super fun detail is that all of the fur is combed out but there were a few strands that were wavy and had a slight curl- I LOVED that. There was no odor at all which is great! I expected an animal smell which is better than chlorine or dioxin which is what competitors use in their process. There is no noticeable seam in the middle on the top where the two pelts are gathered. I am soooo satisfied!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2016
S
Verified Purchase
Sreitter1
Draper, US
★★★★★ 5
Exactly as described and what I needed.
Size: 2' x 6' (Natural), Color: Wolf Tipped
I have a bad back along with other medical problems. I bought this for padding in my wheelchair. Very thick, soft, flexible, everything I needed. No smell and very little shedding even initially. Arrived quickly and well packaged.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026

recommand products