SKU: 14985785474

MDL-1 /CLEC5A His Tag Protein, Human

Sale price$315.00 Regular price$350.00
Save 10%

Pay in installments of $87.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MDL-1 /CLEC5A His Tag Protein, HumanProduct Specification Species Human Synonyms CLEC5A Accession Q9NY25 Amino Acid Sequence Pro 28 Lys188,with N terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK Expression System HEK293 Molecular Weight 33 45 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms CLEC5A
Accession Q9NY25
Amino Acid Sequence Pro 28-Lys188,with N-terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Expression System HEK293
Molecular Weight 33-45 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CLEC5A is a spleen tyrosine kinase (Syk)-coupled C-type lectin that is highly expressed by monocytes, macrophages, neutrophils, and dendritic cells and interacts with virions directly, via terminal fucose and mannose moieties of viral glycans. CLEC5A also binds to N-acetyl glucosamine(GlcNAc) and N-acetylmuramic acid(MurNAc) disaccharides of bacterial cell walls. Compared to other C-type lectins(DC-SIGN and DC-SIGNR) and TLRs, CLEC5A binds its ligands with relatively low affinities. However, CLEC5A forms a multivalent hetero-complex with DC-SIGN and other C-type lectins upon engagement with ligands, and thereby mediates microbe-induced inflammatory responses via activation of Syk. For example, in vivo studies in mouse models have demonstrated that CLEC5A is responsible for flaviviruses-induced hemorrhagic shock and neuroinflammation, and a CLEC5A polymorphism in humans is associated with disease severity following infection with dengue virus. In addition, CLEC5A is co-activated with TLR2 by Listeria and Staphylococcus. Furthermore, CLEC5A-postive myeloid cells are responsible for Concanavilin A-induced aseptic inflammatory reactions. Thus, CLEC5A is apromis-Cuous pattern recognition receptor in myeloid cells and is a potential therapeutic target for attenuation of both septic and aseptic inflammatory reactions.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14985785474

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Reesy07
Massapequa, US
★★★★★ 5
Excellent Midlayer for Golf
Color: Light Brown Heather, Size: X-Large
My dad has been wearing this M MAELREG hoodie for about a week now, specifically during my early morning golf rounds where the temperature sits in the low 50s. The fit is true to size with an "athletic" cut, meaning it’s tapered enough to look sharp but has enough stretch and light enough to allow for a full shoulder turn during a golf swing. The cost is also a lot lower than some of the tech golf shirts out there. Overall this is a great shirt for golfing with an expensive look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 4
Good not great
Color: Blue Heather, Size: XX-Large
Good hoodie. Don’t know if it’s worth the price. Would feel better if it was $10 cheaper
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
M
Meigs County Mama
Port Orchard, US
★★★★★ 5
Comfortable and casual enough for daily wear but still looks like you put thought into your look
Color: Grey Heather, Size: 3X-Large
Got this for my husband and was so pleased with the quality and fit. He wears it on top of his tee shirt and says it's one of the most comfortable hoodie he's worn. It's not too thick, but very warm. Great value as he wears it daily. Love the casual style while still looking put together.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
R
Verified Purchase
Robert S
Port Orchard, US
★★★★★ 5
Highly recommend
Big fan, have purchased multiple
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
A
Verified Purchase
a tichler
Lake Worth, US
★★★★★ 4
Strechy and silky
Color: Grey Heather, Size: X-Large
Super stretchy and very silky feeling. It’s the same look at the lulu hoodie with similar material, but it’s different fabric. Very stretchy very silky
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026

recommand products