SKU: 60178646259

Cyclophilin A His Tag Protein, Mouse

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cyclophilin A His Tag Protein, MouseProduct Specification Species Mouse Synonyms Peptidyl prolyl cis trans isomerase A; PPIase A; SP18; PPIA; CYPA Accession P17742 Amino Acid Sequence Met1 Leu164, with C terminal 8*His Tag MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQLHHHHHHHH Expression System E. coli Molecular Weight 19kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g

Product Specification


Species Mouse
Synonyms Peptidyl-prolyl cis-trans isomerase A; PPIase A; SP18; PPIA; CYPA
Accession P17742
Amino Acid Sequence

Met1-Leu164, with C terminal 8*His Tag MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQLHHHHHHHH

Expression System E.coli
Molecular Weight 19kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Haendler B., et al.,(1987), Complementary DNA for human T-cell cyclophilin. EMBO J. 6:947-950. 2. Haendler B., et al., (1990), Characterization of the human cyclophilin gene and of related processed pseudogenes.Eur. J. Biochem. 190:477-482. 3. Ota T., et al.,(2004), Complete sequencing and characterization of 21,243 full-length human cDNAs.Nat. Genet. 36:40-45.

Background

Peptidyl-prolyl cis-trans isomerase A, also known as PPIase A, Rotamase A, Cyclophilin A, Cyclosporin A-binding protein, PPIA and CYPA, is a cytoplasm protein that belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins (CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. PPIA / Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA / Cyclophilin A is secreted by vascular smooth muscle cells in response to inflammatory stimuli, and could thus contribute to atherosclerosis. It is not essential for mammalian cell viability. PPIA / Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60178646259

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Head2shoulder
Charlottesville, US
★★★★★ 5
Big and cute novelty toy
I got it for my 94 year old mother-in-law, but the 2 dogs loved the box and the ring.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2025
T
Verified Purchase
Tennessee Gidget
Draper, US
★★★★★ 4
If Your Dog Wants to Tie the Knot
This is about the only diamond ring toy of its type, for a dog, that I have been able to find, and it filled the need perfectly. I would have given it 5 stars, but I thought that the price was a few dollars higher than necessary. I needed it quickly though, and it was delivered in rural Tennessee within 48 hours. It's a 2 part dog toy that probably wouldn't hold up especially well if your dog is rough on stuffy toys. My girl is gentle, and it doesn't have any squeakers in it, so it will last. I imagine it will wash well in a garment bag, although I haven't done that yet. If your dog wants to tie the knot, this is the ring for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2024
K
Verified Purchase
kevin lopez
San Leandro, US
★★★★★ 5
I received the product
It looks good and amazing just like in pictures My lady likes it great gift for her
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 24, 2023
B
Verified Purchase
Beverly B
Houston, US
★★★★★ 5
Adorable
This dog stuffy is adorable! I can’t wait for my son & bride to be to see their favourite pup make an appearance at their wedding carrying it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2025
B
Verified Purchase
Betsy
Alexandria, US
★★★★★ 5
One of the best dog toys I’ve found
Color: Blue, Color: Blue
My Great Dane puppy- at 140lbs, loves this!! We had another one that was plastic and it worked ok but this is so much better! Interactive, soft to play with, battery last a long time & he does not get bored with it. Besides is plush lamb chops, best toy ever bought for him.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products