SKU: 14928151834

CDK12/Cyclin K Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CDK12/Cyclin K ProteinProduct Specification Species Human Accession Q9NYV4 1O75909 3 Amino Acid Sequence CDK12: Q696 S1082

Product Specification


Species Human
Accession Q9NYV4-1、O75909-3
Amino Acid Sequence

CDK12: Q696-S1082

QPYKKRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVKNS

Cyclin K:  M1-S300

MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS

Expression System Baculovirus-InsectCells
Molecular Weight CDK12: 61.7 kDa; Cyclin K: 48.1 kDa
Purity >85% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 20 mM reduced glutathione , 1 mM DTT, 0.05% Brij35, 10% glycerol, pH 7.5
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14928151834

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AMW
Lexington, US
★★★★★ 5
Great Printer
Set name: Sublimation Printer
Great Printer, love it over my epson sublimation printer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
Y
Verified Purchase
yodan2
San Leandro, US
★★★★★ 5
Great value
Set name: Sublimation Printer
This is my first sublimation printer and I am very happy with this printer. The photos that I have printed have been very good quality and vibrant colors and have applied really well to the sublimation blanks I have used. I like that it will self clean the heads as long as the printer power is on. It was important to me to get an actual sublimation printer in order to have the warranty on it. The printer works with the Artspira app. This app is only available on a smart phone or tablet. It is very difficult to design on such a small screen. Brother needs to have a program that will work on a computer to make designing easier. I did gave difficulties getting my phone to connect to the printer after I designed my work on the very small screen. I used the chat feature on the Brother site and they were able to help me get it connected in order to print.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2024
B
Verified Purchase
Bruce
Dallas, US
★★★★★ 5
Printer
Set name: Sublimation Printer
Bought is a Christmas gift. Has not been turned off since. Lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
M
Verified Purchase
Ms.S.Butta
New York, US
★★★★★ 1
NOt good... not great... horrible
Set name: Sublimation Printer
I’m thoroughly disappointed with the Brother Sublimation Printer and would not recommend it. Out of the box, the setup process was more complex than anticipated, with unclear instructions and frequent errors. The print quality was inconsistent, with colors often coming out dull or inaccurate, despite multiple attempts at calibration. I experienced frequent paper jams, which disrupted my workflow and wasted a lot of materials. The printer’s software is buggy and doesn’t integrate well with other design programs, making it frustrating to use. The connectivity options were unreliable, causing frequent disconnections and delays. Additionally, the printer is quite noisy during operation, which can be distracting and bothersome. The build quality feels flimsy and not as durable as I expected. The customer support experience was also poor, with slow response times and unhelpful solutions. I faced issues with ink usage, as the cartridges seemed to run out quickly, leading to higher operational costs. The sublimation prints didn’t have the sharp, vibrant quality I was hoping for, making my final products look less professional. The lack of clear troubleshooting guides added to the frustration. The printer’s design is bulky and takes up more space than I anticipated. Overall, this Brother Sublimation Printer has been a letdown in terms of performance, reliability, and ease of use. I regret investing in this product and would advise looking for alternatives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2024
R
Verified Purchase
Roy Adorjan
Port Orchard, US
★★★★★ 4
Pretty good for the price.
Set name: Sublimation Printer
So far so good. I have been producing a fair amount of items to date. My only wish was that the colors were more vibrant with this printer and it's ink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025

recommand products