SKU: 14011263247

LILRB2/CD85d/ILT4 His Tag Protein, Cynomolgus

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB2/CD85d/ILT4 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Accession BAE87348. 1 Amino Acid Sequence Gly24 Leu448, with C terminal 8*His

Product Specification


Species Cynomolgus
Accession BAE87348.1
Amino Acid Sequence Gly24-Leu448, with C-terminal 8*His GTLPKPMLWAEPGSMISEGSPVTLRCQGSLQVQEYRLYKGKKPASWVRRIQQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVSLQCDSQVTFDGFVLCKEGEDEHPQRLNSQSHARGWSWAVFSVVPVSPSRRWSYRCYGYDSHSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCGSDVGYDRFALYKEGERDFLQRPSRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILISGQIRGTPFLSVQPGPTVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAELSMSPVTSAHAGTYRCYGSLSSNPYLLSVPSDPLELVVSGAVDTLGLSQNNSETKTASHSQDYTVENLGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 63-70kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B2 (LILRB2) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85D, ILT4, LIR2, and MIR10, contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic ITIMs. It is expressed on hematopoietic stem cells, monocytes, macrophages, DCs, neutrophils, basophils, platelets, and activated CD4+T cells, as well as in vitro cultured endothelial cells, mast cell progenitors, and osteoclasts. LILRB2 plays physiological roles in multiple tissues. LILRB2 is involved in immunotolerance in pregnancy and transplantation. HLA-G/LILRB2 interactions promote accumulation and the suppressive activity of MDSCs during human pregnancies. Crosslinking of LILRB2 with Fcγ R in vitro led to inhibition of Fcγ R-mediated signaling in monocytes and serotonin release in basophilic cells. Upregulation of LILRB2 induced the tolerance of DCs. Interaction of LILRB2 with HLA class I molecules is positively associated with viral replication in HIV, suggesting that this interaction leads to a blunted immune response. Upregulation of LILRB2 and LILRB4 in antigen-presenting cells in response to Salmonella infection suggests a role for these receptors in balancing the inflammatory response against bacterial infection. LILRB2 is localized in neutrophil lipid rafts and rapidly moves to the cell surface upon neutrophil stimulation. This upregulated LILRB2 then enhances the inhibitory signals of HLAG on the phagocytic function of neutrophils. Future studies are required to shed light on how neutrophil and immune responses are modulated through LILRB2 interactions with this diverse set of ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14011263247

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alok Dwivedi
Louisville, US
★★★★★ 4
Decent, but look big on the feet.
Size: 11, Color: Taupe, Size: 11, Color: Taupe
They fit a little large, or at least they look a little large for my feed, so I think they might not work for dressy outfits well. The quality is good thick, style and color are accurate. however, they can make a slight squeak. Value for money is good, as you can get it for discounts sometimes. they seem durable, comfort wise, I would say that they are okay, for city lifestyle, if you dont have a lot of activity to do, except some walking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2026
P
Verified Purchase
paul
Fort Morgan, US
★★★★★ 5
Versatile and well priced
Size: 11, Color: Black
Great for the price. Look good for kicking it around town or for a business casual work place. They fit great, they're comfortable, the black is deep, and the price is right.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
D
Verified Purchase
Dong
Bozeman, US
★★★★★ 5
Nice Sneakers
Size: 9, Color: Black
Very comfortable and easy to wear. They feel lightweight and fit true to size. Good value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
A
Verified Purchase
Amazon Customer
Charlottesville, US
★★★★★ 1
Loud, cheap shoes
Size: 9, Color: Black
Loud and squeaky, making them unwearable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
X
Verified Purchase
xxscallerxx
New York, US
★★★★★ 3
Becareful of the shoe size
Size: 8, Color: Black
the size was not what i expected, most shoes i wear have always been a size 8, but this one was a bit tight. I asked a question on the page if the size is based on UK or US since there's a 1 size difference. but it said it was US standard reference. perhaps buying a size 9 would fix this issue for me. The quality of the shoes however is very great, compared to the basic shoe affordable brands you get this one has better quality, they're light and great whether you're stationary or actively jogging or walking. just the size was lacking in fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 9, 2026

recommand products